(data stored in ACNUC7421 zone)

EMBL: CP002293.PE525

CP002293.PE525       Location/Qualifiers
FT   CDS_pept        578045..579043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0549"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: gwc:GWCH70_2876
FT                   phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73381"
FT                   /db_xref="GOA:A0A0F6BIY0"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIY0"
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /protein_id="ADP73381.1"
FT                   /translation="MDTVFLLTVLIVVFALAFDFINGFHDTANAIATSVSTRALSPRKA
FT                   IVLAATMNFIGALTFTGVAKTITKDIVDPFALENGSVVILAALTAAIAWNLITWYYGIP
FT                   SSSSHALIGSIAGAAVSAAGFDVLHYQGFLKILESLIISPFLALAVGFVIMSLFRAIFK
FT                   NANLTRTTKGFRMFQVITAAFQAYTHGTNDAQKTMGIITMALIAANYHTSSEVPEWVRI
FT                   SAAIAMGLGTSVGGWKIIKTVGGKIMKIRPVNGAAADLSSALVIFSATLLHLPVSTTHV
FT                   ISSSIMGVGAAQRVKGVKWGVAQRIVLTWIITLPVSALIAGFVYQIFKLFF"
     atggatacag tatttttact tacggttctt attgtcgttt ttgcattggc gtttgatttt        60
     attaacgggt ttcatgatac cgccaatgcc attgcaacat ctgtctcaac gcgagcattg       120
     tcgccgcgga aagcgattgt tttagcggca accatgaact ttattggcgc attgacgttt       180
     actggcgttg cgaaaacgat cacgaaagac attgtcgacc cattcgcgct tgagaacggt       240
     tcggttgtca ttttagcggc attgacggcg gcgattgcat ggaatttaat tacgtggtat       300
     tacggaatcc cgagcagttc ttcgcatgcg ttgatcggtt cgattgcggg cgccgctgtt       360
     tcggcggcgg gatttgatgt tttgcattat caaggctttt taaaaatttt agaatccctt       420
     attatctcgc cgtttctcgc tttagcagtc gggtttgtca tcatgagctt gtttcgtgcc       480
     atttttaaaa acgccaactt gacgcggaca acgaaagggt tccgcatgtt tcaagtcatc       540
     accgctgctt ttcaagcgta tacgcacgga accaacgatg cgcaaaagac gatgggaatt       600
     atcacgatgg cgcttattgc tgcgaactat catacgtcaa gtgaagtgcc ggaatgggtg       660
     cgaatttctg ctgccattgc gatgggattg ggcacatctg ttggcggatg gaaaattata       720
     aaaaccgttg gcggcaaaat tatgaaaata cgtcctgtta acggggcggc tgccgattta       780
     tcatcggcac tcgtcatttt ctccgccact ctccttcatt tgccggtcag cacgactcat       840
     gttatctctt catcgattat gggagtcgga gcggcacagc gcgttaaagg cgtcaaatgg       900
     ggtgtggcgc agcgcattgt gttaacatgg attattacat tgccggtttc tgcacttatt       960
     gctggatttg tctatcaaat ttttaaatta tttttttga                              999
//

If you have problems or comments...

PBIL Back to PBIL home page