(data stored in ACNUC7421 zone)

EMBL: CP002293.PE526

CP002293.PE526       Location/Qualifiers
FT   CDS_pept        complement(579113..579721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0550"
FT                   /product="BioY protein"
FT                   /note="PFAM: BioY protein; KEGG: gwc:GWCH70_2875 BioY
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73382"
FT                   /db_xref="GOA:A0A0F6BIY1"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIY1"
FT                   /inference="protein motif:PFAM:PF02632"
FT                   /protein_id="ADP73382.1"
FT                   /translation="MGETQRKWRALDMTLVGMFAALMAIGANITSWAPFLVIGGVPITL
FT                   QTFFCVLAGAILGRKLGATAMTVYMLIGLFGAPVFAQFSGGFGTIVRPTFGFILSFILA
FT                   AYVTGWIIERGNGNPSVVRFIAATVAGMAINYLIGTNWMYIAYKLWAEAPKGFSYALAW
FT                   SWMIVPLPKDIILSVIAGIISPRIYMSIRKSASYRQHVA"
     atgggagaaa cacagcggaa atggcgggca cttgacatga cattagtcgg catgtttgcg        60
     gcattaatgg caattggggc aaatattacg tcatgggcgc catttcttgt catcggcggt       120
     gttccaatta cgttgcaaac gttcttttgc gtgcttgccg gcgcgatttt agggcgcaaa       180
     ttaggagcga cagcaatgac cgtttatatg ttaatcggtc tattcggcgc tccggtgttt       240
     gcccagttta gcggcggatt cggcactatt gtccgcccga cattcggatt tatcctatcg       300
     tttattttgg ctgcttacgt gacaggctgg attattgaac gaggaaacgg gaatccgtcc       360
     gttgtccggt ttattgctgc gacggtcgct ggtatggcaa ttaactactt gatcggcacc       420
     aactggatgt atatcgccta taaactttgg gcggaagctc ctaaagggtt ttcgtatgct       480
     ttggcatgga gctggatgat cgttccgctt ccaaaagata ttattttatc cgtaattgcc       540
     gggatcatct caccacgaat ttatatgtcc atccgtaaat ccgcttcata ccgccaacat       600
     gtggcatag                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page