(data stored in SCRATCH zone)

EMBL: CP002293.PE527

CP002293.PE527       Location/Qualifiers
FT   CDS_pept        complement(579974..581302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0551"
FT                   /product="Citrate transporter"
FT                   /note="PFAM: Citrate transporter; KEGG: gka:GK2936
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73383"
FT                   /db_xref="GOA:A0A0F6BIY2"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIY2"
FT                   /inference="protein motif:PFAM:PF03600"
FT                   /protein_id="ADP73383.1"
FT                   /translation="MHDSAAAEISSLQYYAAIAIFLITYAIIISEKINRAVIAMLGAAL
FT                   MIMFGIVDLHNAFTQHIEWGTITLLIGMMILVGITSKSGFFQYVAIKAAKLAKGRPLRI
FT                   LVMLSLLTGALSAFLDNVTTVLLIVPVTFSITRMLQVNPVPYLISEVLFSNIGGTATLI
FT                   GDPPNIMIGSANKHLDFNAFLFNLTPIVLIIMIVTVSILVFIYRRQLKTDDHLVNKLMN
FT                   VNEAEYIKDAALLKKSVSVLFLTILGFLLHSVIHVDAAVIAMTGAIILMLIGVQEHEIE
FT                   DVFASVEWVTIFFFAGLFTLVGGLVDIGFIKSLAEKVLEVTGGDISAAAYFILWVSGLA
FT                   SATIDNIPFVATMIPLIKDMAAGMGLSPDSAQMEVLWWALSLGACLGGNGTLIGASANV
FT                   IVAGIASREGHGFSYMDFLKIGAPLTFIALLLSHIYLFVRYLM"
     atgcatgact cagcagcagc cgaaatttcc agcttgcaat attatgcggc gatcgccatt        60
     tttcttatca cgtacgccat catcatttcg gaaaaaatca accgggctgt cattgccatg       120
     ctcggtgccg cattgatgat tatgttcggc atcgttgatt tgcataacgc gtttactcaa       180
     catattgaat ggggaacgat aacccttttg ataggaatga tgattctcgt cggcattaca       240
     agcaaatccg gtttttttca atacgtggca attaaagcgg cgaaattggc gaaaggacgg       300
     ccgttgcgca ttttagtgat gctgtcgctg ttgacgggcg ctttatcggc ctttcttgac       360
     aatgtcacga cggtattgtt gattgttcct gtgacatttt ccatcacacg catgttgcaa       420
     gttaacccgg ttccttattt aatctcggaa gtgttgtttt ccaacattgg cggaacggca       480
     acattgatcg gcgacccgcc aaatattatg atcggatcgg caaacaaaca tctcgacttc       540
     aacgcgtttt tgtttaattt aacgccgatt gtactcatta ttatgatcgt tacggtatcc       600
     attcttgttt ttatataccg ccggcaacta aaaacagacg atcaccttgt gaacaaattg       660
     atgaatgtga acgaagcaga atatattaaa gatgcggcat tgttaaaaaa atctgtatcc       720
     gtgttatttt tgacgatttt aggttttctc cttcattccg tcattcatgt cgatgccgct       780
     gtcatcgcaa tgacaggcgc gatcatatta atgctaattg gcgtgcaaga acatgaaatc       840
     gaagacgtat ttgcctctgt cgaatgggta acgatctttt ttttcgccgg cctctttaca       900
     ttagttggcg gactcgtcga tatcggattt atcaaaagct tggcggaaaa agtgttggaa       960
     gtcaccgggg gcgatatttc tgccgctgcc tatttcatcc tttgggtatc ggggcttgct      1020
     tcagcaacaa ttgataatat cccgtttgtc gccacgatga ttccgctgat taaagacatg      1080
     gctgccggaa tgggattatc gccggattcc gcacaaatgg aagtattgtg gtgggcatta      1140
     tcattaggcg catgtttagg gggaaacggc acgttaatcg gcgcttcagc aaatgtgatt      1200
     gtcgccggca tcgcttcgcg tgaagggcac ggattcagct atatggactt tttaaaaatc      1260
     ggcgctccgt taacattcat cgcgcttttg ctttctcaca tctatttgtt tgtccgttat      1320
     ttaatgtag                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page