(data stored in ACNUC7421 zone)

EMBL: CP002293.PE528

CP002293.PE528       Location/Qualifiers
FT   CDS_pept        581698..582321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0552"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="KEGG: exonuclease RNase T and DNA polymerase III;
FT                   PFAM: Exonuclease RNase T and DNA polymerase III; SMART:
FT                   Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73384"
FT                   /db_xref="GOA:A0A0F6BIY3"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIY3"
FT                   /inference="protein motif:PFAM:PF00929"
FT                   /protein_id="ADP73384.1"
FT                   /translation="MTATSQYLFLDFEFTMPETKMEPKGFFPEIIEVGLVVVVNDEICD
FT                   QFSSYVKPTRFPVLTNRCKSFLNITQEQINQGMSFHELVALLCKYDRSCPSTVVTWGSM
FT                   DMKVLKENCKAANLPFPFTGEHRDLAMEYKLFFGNKNHTGLRKAIQEYGNEGVGKAHCA
FT                   LDDAFTTYNIFRLVENDKKYLMKTKPPTIGERIDLTQLRKKFAL"
     gtgacagcga catcacaata cttgttcctt gattttgaat ttacgatgcc ggaaacaaaa        60
     atggagccaa aaggattttt tccggaaatt attgaagtcg ggcttgttgt ggttgtcaat       120
     gatgaaatat gcgaccagtt ttcctcttat gtgaaaccga cgcgctttcc agtgcttacg       180
     aaccggtgca aatcgttttt aaatattacc caagaacaaa tcaatcaagg aatgagcttt       240
     cacgaactag tcgcattatt gtgcaagtac gatcgttcgt gcccaagcac ggtggttaca       300
     tggggaagca tggacatgaa agtgttaaag gaaaattgca aggccgctaa tctgccgttt       360
     ccttttacgg gagagcaccg cgatctggcg atggaatata aattgttttt tggaaacaaa       420
     aatcatacag gattgcgaaa ggcgatacaa gaatatggaa atgaaggagt aggaaaagcg       480
     cattgtgctt tggacgatgc ttttaccact tataatattt tccggctggt agaaaacgat       540
     aaaaaatatt taatgaaaac aaaaccgccg acgattggag aacgaatcga tttaacgcag       600
     ctaagaaaaa aatttgcgtt atga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page