(data stored in SCRATCH zone)

EMBL: CP002293.PE529

CP002293.PE529       Location/Qualifiers
FT   CDS_pept        582410..582613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0553"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_2866 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73385"
FT                   /db_xref="GOA:A0A0F6BIY4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIY4"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_2866"
FT                   /protein_id="ADP73385.1"
FT                   /translation="MAVSYILSFMLYFPEDKREYIPAAVTCMIFLIAAILTTRLIIKIS
FT                   RYQEEKAKRLEEQLIRDNKNQE"
     atggcggttt cgtatatatt aagtttcatg ctatattttc ctgaagataa acgcgagtat        60
     attcctgcag cagtcacatg catgattttt cttatagcag ctattttaac aacacggctc       120
     attataaaaa tttcgcgata tcaggaagaa aaggcaaagc ggctggaaga acagctaata       180
     agagataaca agaatcaaga ataa                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page