(data stored in SCRATCH zone)

EMBL: CP002293.PE530

CP002293.PE530       Location/Qualifiers
FT   CDS_pept        582686..583210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0554"
FT                   /product="superoxide dismutase copper/zinc binding protein"
FT                   /note="PFAM: superoxide dismutase copper/zinc binding;
FT                   KEGG: gwc:GWCH70_2865 superoxide dismutase copper/zinc
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73386"
FT                   /db_xref="GOA:A0A0F6BIY5"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIY5"
FT                   /inference="protein motif:PFAM:PF00080"
FT                   /protein_id="ADP73386.1"
FT                   /translation="MFQKAGLLFAAAVLFAVGCQKENVTNLEVNMINSAGDSIGTVKLT
FT                   EQAKGVKLKLDLEGLPPGEHAIHIHEKGVCKKPDFQSAGNHYNPDGKKHGLLHPEGAHA
FT                   GDLPNIIVKEDGTVNTELTAPNVTLKEGKKGTLLTKDGTAIVIHAGKDDGMTQPAGDAG
FT                   ERIACGEIKNR"
     gtgtttcaaa aggcaggttt gttattcgcg gccgccgttt tatttgccgt cggctgccaa        60
     aaggaaaatg tgacgaattt agaagttaac atgataaata gcgccggtga ttccatcggc       120
     acggtgaagc taaccgaaca agcgaaaggg gtgaaattga agctggattt ggaagggctt       180
     ccgcctggtg aacacgcgat tcatattcac gaaaaaggag tttgcaaaaa accggatttt       240
     caatcggctg gaaaccacta caatccagac ggaaaaaaac atggattgct tcatccagaa       300
     ggagcgcatg ctggcgactt gcctaatatt atcgtaaaag aggacgggac agttaacacg       360
     gaattgaccg cgccaaatgt gacgctgaaa gaaggaaaaa aagggacgtt gttaactaaa       420
     gatgggacgg cgattgtcat ccacgccgga aaagatgatg ggatgacgca gccggctgga       480
     gatgctgggg aacgaattgc atgtggagaa ataaaaaata gatga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page