(data stored in ACNUC7421 zone)

EMBL: CP002293.PE531

CP002293.PE531       Location/Qualifiers
FT   CDS_pept        complement(583326..584486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0555"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   gwc:GWCH70_2864 aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73387"
FT                   /db_xref="GOA:A0A0F6BIY6"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027619"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIY6"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADP73387.1"
FT                   /translation="MYSFDDVIDRRNTHSLKWDATERIFGVKDVLPMWVADMDFPAPPA
FT                   VIEALNKRVEHGIFGYTIIPDSLKNAVKHWLQSRHQWEIETSWLSFSTGVIPAIATAIE
FT                   AFTNEEDRIVVLTPVYPPLFQLVKKHRRTLVTSSLRLAETQYEIDWDDFEEKIRGAKLL
FT                   VLCSPHNPGGRVWTKEELIKIGELCVEHGVIVISDEIHADLTLPPYQHVPFASIDPAFA
FT                   EKSVTCIAPTKTFNLAGLQAAAAIIPNETLKRQFNNVQQRQGILTLNTFAVAGAEAAYQ
FT                   HGGEWLDALLPYLQKNINRLCSYIETNLPKLRVIRPEATYLVWVDCRPLGKTERQLKQL
FT                   LLEKGKIAVEFGSKFGEEGRGFIRINIACPQKTLEDALHRLTAALQ"
     atgtattcat ttgatgatgt catcgatcgc cgcaacactc attccttgaa atgggatgcc        60
     accgagcgca ttttcggcgt gaaagatgtg ctgccgatgt gggtagcgga catggatttt       120
     ccagcacctc ctgccgtcat cgaggcgtta aacaaacgag tcgagcacgg cattttcgga       180
     tatacgatca ttcccgattc tttaaaaaac gccgtcaaac attggctcca atcgcggcat       240
     caatgggaaa tcgaaacatc atggctttca ttttccaccg gcgtaatacc ggcgattgcc       300
     acggccatcg aggcgtttac aaacgaagag gaccgcatcg tcgtcttaac gccggtatat       360
     ccgccgctat tccagcttgt taaaaaacat cgccgcacgc ttgtcacaag ctcgctccgc       420
     ctcgcggaaa cccagtatga aattgattgg gacgatttcg aagaaaaaat tcgcggagcg       480
     aaattattgg tgctatgcag cccgcataat cctggaggcc gtgtctggac aaaagaggaa       540
     ttgataaaaa taggggaatt atgtgtggaa catggcgtga tcgtcatttc cgatgaaatt       600
     cacgcagatc ttacgttgcc gccataccaa cacgttccgt tcgcttccat tgatccggca       660
     ttcgccgaaa aaagcgtcac atgcattgcg ccgacgaaaa cgttcaacct cgccgggctg       720
     caagcagccg ccgcgattat tccaaacgaa acgttaaaac ggcaatttaa caacgtacag       780
     cagcggcaag gcattttaac gctgaacacc ttcgcggttg ccggcgcgga agcagcctat       840
     cagcacggcg gggaatggct cgatgcgctc ttgccatatt tgcagaaaaa tatcaatcgc       900
     ctctgttctt atatcgaaac gaacttgcca aaactccgcg tcatccgtcc cgaagcaact       960
     tatctcgttt gggtcgattg ccggccgctt ggcaaaacag aacggcagct caagcagctt      1020
     cttttagaaa aagggaagat cgccgtagaa tttggaagca aatttggcga agaaggaagg      1080
     ggatttatcc gcatcaatat cgcttgcccg caaaaaacgc ttgaagacgc gcttcaccgc      1140
     ctcaccgcag cgcttcaata g                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page