(data stored in SCRATCH zone)

EMBL: CP002293.PE534

CP002293.PE534       Location/Qualifiers
FT   CDS_pept        585452..586624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0558"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   gwc:GWCH70_2861 aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73390"
FT                   /db_xref="GOA:A0A0F6BIY9"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIY9"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADP73390.1"
FT                   /translation="MMQQTKKSYVSETVARLKPSGIRRFFDLASSMEGVVSLGVGEPDF
FT                   VTSWSIREASILSLEQGYTSYTANAGLLELRQEIAAYLARKFHVEYDPEAEILVTVGAS
FT                   QAIDLALRATVNPGDEVIVVEPSFVSYGPLVTLAGGVPVPVGTTGEDHFKLRPDQIERV
FT                   ITDRTKALIVCSPNNPTGTVLHKEDLEAIAQIVKKHDLLVISDEIYAELTYDEPYISFA
FT                   AVDGMRERTILVSGFSKGFAMTGWRLGFTAAPAEILQAMLKIHQYAIMCAPTMAQYAAI
FT                   EALRNGEQDVEYMKKSYRRRRNYFVQSLNEIGLSCHMPGGAFYAFPSIRATGLTSEQFA
FT                   EKLLLEEKVAVVPGSVFGAGGEGYIRCSYASSMEQLQEAIKRIKRFLERL"
     atgatgcagc aaacgaaaaa atcgtatgtg tcggaaacgg ttgctcgtct gaagccatcg        60
     ggaatacggc gtttttttga ccttgcttcc agcatggaag gagtagtttc cctcggcgtg       120
     ggcgagccgg attttgtgac atcatggagc atacgggaag cgtctatttt atcgctcgag       180
     caaggatata catcatatac ggcaaatgcc ggccttttgg agcttcgcca agaaatcgcc       240
     gcatatttgg cgcgcaagtt tcatgtggaa tacgatcccg aagcagaaat tcttgtcacg       300
     gtcggtgcaa gccaagccat tgatttagcg ctgcgggcga cggtgaatcc tggggatgaa       360
     gtcattgttg tcgagcctag ctttgtttct tacggaccgc ttgttacgct ggcgggtgga       420
     gtgccggttc cggttggaac aaccggagaa gatcatttta agcttcgtcc ggatcaaatc       480
     gagcgggtaa ttactgatcg cacaaaagcg ctgatcgttt gttccccgaa caatccgaca       540
     ggcaccgtgc ttcataaaga agatttggaa gctatcgcgc agattgtgaa aaagcatgat       600
     ttgcttgtca tttctgatga gatttacgcc gagctgacgt atgacgagcc gtacataagc       660
     tttgcggcag ttgacgggat gcgggagcgg accattttgg tttctggttt ttcgaaaggg       720
     tttgcaatga ccggctggcg gctcggattc accgcggcgc ctgcggaaat tttgcaggcg       780
     atgcttaaaa ttcatcagta tgcgatcatg tgcgcgccga caatggcgca atacgccgcg       840
     attgaagcgt taagaaacgg cgaacaagat gtggaatata tgaaaaaaag ctatcggcgc       900
     cgccgcaatt attttgtcca gtcattaaat gaaatcgggc tcagctgcca tatgcccggc       960
     ggagcatttt acgcttttcc gtcgattcgg gcgacggggc tgacatcgga acaatttgcg      1020
     gaaaagctgt tattggaaga aaaagtggcg gtggttcctg ggagcgtgtt tggcgcagga      1080
     ggggaaggat atattcgctg ctcctacgct tcctccatgg aacaactgca agaagcgatc      1140
     aagcggatca aacgcttttt agagcggttg taa                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page