(data stored in SCRATCH zone)

EMBL: CP002293.PE537

CP002293.PE537       Location/Qualifiers
FT   CDS_pept        587535..588698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0561"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   gwc:GWCH70_2858 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73393"
FT                   /db_xref="GOA:A0A0F6BIZ2"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIZ2"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ADP73393.1"
FT                   /translation="MENFSFQNPTKLIFGKGQIEQLKEEIPRYGKKILLVYGGGSIKRN
FT                   GLYDEVMNLLNELKVEVTELPGVEPNPRLSTVRKGVEICKTEGIEFLLAVGGGSVIDCT
FT                   KAIAAGAKYDGDPWDFITKKVKVFEALPFGTVLTLAATGSEMNAGSVITNWETKEKYGW
FT                   NSPATFPQFSILDPTYTLTVPRDHTVYGIVDMMSHVFEQYFHHTANTPLQDRMCEAVLR
FT                   TVMEAAPKLVNDLQNYELRETILYCGTIALNGLLQMGLRGDWATHNIEHAVSAVYDIPH
FT                   AGGLAILFPNWMKHVLDENVSRFAQLAVRVFDVNPEGKAERDVALEGIEKLREFWSSIG
FT                   APSRLADYGIGEESLELIADKAMANGEFGKFKKLNRDDVLAILRASL"
     atggaaaatt tttcttttca aaatccgact aaattaattt ttgggaaagg gcaaattgaa        60
     cagctgaagg aggaaatccc ccgttacggg aaaaaaatcc ttctcgttta tggcggcggc       120
     agtattaaac ggaacggctt gtatgatgaa gtaatgaact tattgaatga attaaaggtg       180
     gaagtaacag aacttcctgg cgtggagcca aatccgcgct tgtccactgt gcggaaaggc       240
     gtggaaattt gcaaaacgga aggaattgag tttttgctcg cggttggcgg cggcagtgtc       300
     attgattgca cgaaggcgat cgcggcgggt gcgaaatatg atggcgatcc gtgggatttc       360
     atcacaaaga aagtgaaagt tttcgaagcg cttccgtttg ggacagtgtt aacgcttgcg       420
     gcaaccggat cagaaatgaa cgccggttcg gtgattacaa actgggagac gaaagaaaaa       480
     tatggctgga acagtccggc gacgttcccg caattttcga ttctcgatcc tacctatacg       540
     ctcacagttc cgcgggatca tacggtttat ggaatcgtcg atatgatgtc ccatgtgttt       600
     gaacaatatt tccatcatac ggcgaatacc ccgctgcaag accggatgtg tgaggcggta       660
     ttgcgcacgg tcatggaagc ggcgccaaaa ctagttaatg atttgcaaaa ctatgagctg       720
     cgggaaacga ttttatattg cggcactatc gctctcaacg gcttgttgca aatggggctc       780
     cgcggcgact gggcgacgca taacatcgag catgcggtgt cagcggttta tgatattccg       840
     cacgccggag ggctggcgat tttattcccg aactggatga agcatgtgct tgatgaaaat       900
     gtcagccggt ttgcccaatt agctgttcgc gtttttgacg tgaatcctga agggaaagcg       960
     gaacgggacg tagcgttaga aggaattgaa aaattgcgcg aattttggtc aagcattggg      1020
     gcgccgtcac ggcttgccga ttacggaatc ggcgaagaaa gtttagaatt aatcgctgac      1080
     aaagcaatgg cgaacggcga atttggcaag ttcaaaaagt taaaccgcga cgatgtgctg      1140
     gcgattttgc gcgcatcgtt ataa                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page