(data stored in ACNUC7421 zone)

EMBL: CP002293.PE538

CP002293.PE538       Location/Qualifiers
FT   CDS_pept        588858..590207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0562"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="KEGG: gwc:GWCH70_2857 glucose-6-phosphate isomerase;
FT                   PFAM: phosphoglucose isomerase (PGI)"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73394"
FT                   /db_xref="GOA:A0A0F6BIZ3"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIZ3"
FT                   /inference="protein motif:PRIAM:5.3.1.9"
FT                   /protein_id="ADP73394.1"
FT                   /translation="MTHIRFDYSKALAFFGEHELTYLRDAVKVAHHSLHEKTGVGNDFL
FT                   GWIDLPVNYDKEEFARIQKAAAKIQADSDVLLVIGIGGSYLGARAAIEMLHHSFYNALS
FT                   KEKRRTPQIIFVGNNISSTYMKDVMDLLEGKDFSINVISKSGTTTEPAIAFRIFRKLLE
FT                   EKYGKEEARKRIYATTDRARGALKTLATAEGYETFIIPDDVGGRYSVLTAVGLLPIAVS
FT                   GANIEEMMKGAAQAREDFSNSELEENAAYQYAAIRNILYNKGKTIELLINYEPALQYFA
FT                   EWWKQLFGESEGKDQKGIFPASANFSTDLHSLGQYIQEGRRDLFETVLKVEKPRHELVI
FT                   EAEENDLDGLNYLAGKTVDFVNTKAFEGTLLAHTDGGVPNLVITLPELNEYTFGYLVYF
FT                   FEKACAMSGYLLGVNPFDQPGVEAYKVNMFALLGKPGYEEKKAELEKRLK"
     atgacacata ttcgttttga ttattcaaaa gcattggcgt tttttggcga acatgaactt        60
     acgtatttgc gcgatgcggt gaaagttgct catcattccc ttcacgagaa aacaggcgta       120
     ggcaatgatt ttttgggctg gatcgatttg ccggtgaatt atgataaaga agaatttgcc       180
     cgcattcaaa aagcagccgc aaaaattcaa gcagattccg atgtgctgtt agtaattgga       240
     atcggcggtt catatttagg ggcgcgcgca gcgatcgaga tgctccatca ttcgttttat       300
     aacgcgcttt cgaaagaaaa acgccgcacg ccgcaaatca ttttcgttgg caataacatt       360
     agctcgacat atatgaaaga tgttatggat ttgctggaag gcaaagattt ctccattaac       420
     gttatttcaa aatcgggaac gacgacagag ccggctattg cgttccgtat tttccgcaaa       480
     ctgttggaag aaaaatacgg gaaagaagaa gcgcgcaaac ggatttacgc gacgacggac       540
     cgggcgcgtg gcgcgttaaa aacattggcg acggcagaag gatatgaaac attcatcatt       600
     ccggacgatg tcggcggccg ttattctgtg ttaacggcgg tagggcttct gccaattgcc       660
     gtaagcggcg caaacatcga agaaatgatg aaaggagcgg cgcaagcacg cgaagacttc       720
     agcaactctg aactggaaga aaacgctgct tatcaatatg cagcgatccg caacattttg       780
     tataacaaag gaaaaaccat tgagctgctg atcaactatg aacctgcact gcaatatttt       840
     gcggaatggt ggaagcagtt gtttggcgaa agtgaaggca aggatcaaaa agggattttc       900
     ccggcatcag cgaacttctc gacagatctt cattcattgg gacaatacat ccaagaaggg       960
     cgccgcgatt tgtttgaaac ggtattgaaa gtcgaaaaac cgcgccatga gttagtcatc      1020
     gaagcagagg aaaacgattt agacggattg aattatttgg caggaaaaac ggttgatttt      1080
     gtcaatacga aggcatttga aggaacgctt ctcgcccata cggatggcgg tgtgccgaat      1140
     ttagtgatca cccttccaga attaaatgaa tatacgtttg gttacctcgt ctatttcttt      1200
     gaaaaagctt gcgcaatgag cggttactta ttaggggtaa atccatttga ccaaccaggc      1260
     gtagaagcgt ataaagtcaa tatgtttgcc ctccttggca aaccaggata cgaagagaaa      1320
     aaagcggaac ttgaaaaacg cttgaaataa                                       1350
//

If you have problems or comments...

PBIL Back to PBIL home page