(data stored in ACNUC7421 zone)

EMBL: CP002293.PE54

CP002293.PE54        Location/Qualifiers
FT   CDS_pept        66146..67609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0054"
FT                   /product="MazG family protein"
FT                   /note="KEGG: gwc:GWCH70_0053 MazG family protein; TIGRFAM:
FT                   MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase; Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72910"
FT                   /db_xref="GOA:A0A0F6BHK9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHK9"
FT                   /inference="protein motif:TFAM:TIGR00444"
FT                   /protein_id="ADP72910.1"
FT                   /translation="MNTIYVFGLGAGDIEQLPLGVYRKLKTASPLFLRTKEHPVVHALQ
FT                   AEGVSFTSFDAIYEKHERFEDVYEEMAAILLEQAQKNDVFYAVPGHPLVAEKTVQLLLE
FT                   AERRKQCRVVIEGGQSFLDALFTTLKIDPIEGFQLIDATSFQGDEWQLTNHTIFCQVYD
FT                   SFIASEVKLTLMEQLPDDYPVYIVTAAGSKEEKVMEVPLYELDRATVLNNLTSVYVPPV
FT                   REETMLYHRFETLRRVIATLRGPNGCPWDRKQTHESLKRYLLEETYELFEAIDENDDEH
FT                   MVEELGDVLLQVMLHAQIGEDEGMFSIDDVIRGITEKMIRRHPHVFGDVTVENAEQVVE
FT                   NWQRIKEKEKQDRADSLLDDVPKSLPNILRAYEFQKKAAKVGFDWDDVKPMWEKVEEEM
FT                   AEFKREALGEKTVRSRLISEFGDILFALINVARYYGINPEEALHATNQKFYRRFSYIEE
FT                   QARKNGVALTSLSLAELDRFWEEAKEKGW"
     atgaatacga tttatgtttt cggtttaggc gctggcgata ttgaacaatt gccattaggc        60
     gtgtatcgga agctgaaaac cgcttctccg ctttttttgc gaacgaaaga acatccggtt       120
     gtccatgccc tgcaagcgga gggagtttcc tttacgtcat ttgatgccat ttacgagaaa       180
     catgaacggt ttgaagacgt atacgaagaa atggcggcta ttttactgga acaggcgcaa       240
     aaaaacgatg tattttacgc cgttcccggc catccgcttg tagcggaaaa gaccgtgcag       300
     cttttgctgg aagcggaacg gcgcaagcaa tgccgcgtcg tcattgaggg aggccaaagc       360
     tttttagatg ctttgtttac gacgttaaag attgacccga tcgaagggtt tcagcttatt       420
     gacgccacct cgtttcaagg ggatgaatgg caattaacaa atcatacgat tttttgccaa       480
     gtgtatgatt cgtttattgc ctctgaagtg aaattgacat taatggaaca gcttccggac       540
     gactatcctg tctatattgt aacggcggcg ggaagcaaag aggagaaagt gatggaagtt       600
     ccattatacg aacttgaccg tgccacggta ttaaacaatt taacaagcgt atatgttccg       660
     cctgttcgcg aggaaacgat gctttatcac cgttttgaaa cgctgcggcg cgtgattgcg       720
     acattgcggg ggccgaacgg ctgcccgtgg gaccgcaaac aaacgcatga atcgctcaaa       780
     cggtatttgc ttgaagaaac atatgaactg tttgaagcga tcgatgaaaa cgacgatgaa       840
     catatggtcg aggaacttgg cgacgtgctt ttgcaagtca tgcttcatgc gcaaattggc       900
     gaagatgaag gaatgttttc cattgatgat gtcatccgcg gaattaccga aaaaatgatt       960
     cgccgccatc cgcatgtatt cggtgacgtc actgttgaaa atgcagaaca ggttgtagaa      1020
     aattggcagc ggataaaaga aaaagaaaag caagaccgtg ctgattcctt gcttgatgat      1080
     gtaccgaaaa gtttgccaaa tattttaaga gcgtacgaat tccaaaaaaa ggcggcaaaa      1140
     gtaggtttcg attgggacga tgtcaagcca atgtgggaaa aagtagaaga agaaatggct      1200
     gaatttaaac gggaggcact aggagaaaaa acggttcgtt ctcgtctcat tagtgaattt      1260
     ggcgatattt tatttgcgct tatcaatgtt gcccgctatt acggcatcaa tccagaggaa      1320
     gcgctgcatg caacgaacca aaaattttac cggcgctttt cctatatcga agaacaggcg      1380
     cggaaaaacg gcgtagcgct tacgtcactg tcgcttgcag agttagaccg tttttgggaa      1440
     gaagcaaaag aaaaaggatg gtaa                                             1464
//

If you have problems or comments...

PBIL Back to PBIL home page