(data stored in ACNUC7421 zone)

EMBL: CP002293.PE540

CP002293.PE540       Location/Qualifiers
FT   CDS_pept        592207..592611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0564"
FT                   /product="protein of unknown function YugN-like protein"
FT                   /note="PFAM: protein of unknown function YugN-like; KEGG:
FT                   gwc:GWCH70_2855 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73396"
FT                   /db_xref="InterPro:IPR014967"
FT                   /db_xref="InterPro:IPR036491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIZ5"
FT                   /inference="protein motif:PFAM:PF08868"
FT                   /protein_id="ADP73396.1"
FT                   /translation="MIEIPSQLEGKTFPLFQLEQLLKPLGYTIGGNWDYDHGSFDYKIA
FT                   DEAGYQFLRVPFEAIDGQLDSHGTTVKLGRPFLLSHKYQSGVDDHAYAGNFGAAFNQFS
FT                   EPQDPDAAVSEKYINVGKALVKDLENRLID"
     atgatcgaaa ttccatcaca gttggaaggg aaaacgtttc ctctatttca attggagcaa        60
     ttgttaaagc cgcttggtta taccattggc ggaaattggg attatgatca tggttcattt       120
     gattataaaa ttgccgatga agcgggatat caatttttgc gcgttccatt cgaagcaatt       180
     gacgggcagc ttgattccca cggaaccact gtcaagctcg gcaggccgtt tttactgtcg       240
     cacaagtatc aaagcggagt ggatgaccat gcttatgcag gaaattttgg tgcggctttt       300
     aaccagtttt cggagccgca ggaccctgat gcggcggttt cggaaaaata tattaacgtt       360
     ggaaaagcgc tcgtcaaaga tttagaaaat cgcctgatcg attaa                       405
//

If you have problems or comments...

PBIL Back to PBIL home page