(data stored in SCRATCH zone)

EMBL: CP002293.PE541

CP002293.PE541       Location/Qualifiers
FT   CDS_pept        complement(592608..593603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0565"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   Ion transport 2 domain protein; KEGG: gwc:GWCH70_2854
FT                   TrkA-N domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73397"
FT                   /db_xref="GOA:A0A0F6BIZ6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIZ6"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ADP73397.1"
FT                   /translation="MKNWDVFISYLRLPVFMRLLIIGTIMIVIFGTLIHFVEPATFRHV
FT                   FDGIWWAIVTAATIGYGDMVPKTVAGKIVAISLILLGTGVITTYFASLSAAAVAKESAL
FT                   SNGQLRYMQKGHIIIVGWNERAREVIAKLSEYTPPVRCVIIDATLNELPVPFKNVHFIK
FT                   GNPSYDDVLHKANATEAQMILITANQHKSEADADKDSILTLLAVKGIHPSIYAIVEILT
FT                   EQNVNNAKRAGADEVIQTNLLASFTMANSLQSPGVSKAIIELLHQLHGKKLQLIAAEGP
FT                   LIGKTFLESSEMLLDKRMILIGVMREEEGYINPSPHFLIEKGDRLFVITP"
     atgaaaaatt gggatgtgtt catatcgtat ttgcgtcttc ctgtctttat gcgtttgctt        60
     atcatcggga cgatcatgat tgtcattttt ggaacattga ttcatttcgt cgaaccagcg       120
     acgttccggc atgtgttcga cggcatatgg tgggcaatcg tgacagccgc taccatcggc       180
     tatggcgata tggtgccaaa aacggttgct ggaaaaatcg tcgccatttc tctcattttg       240
     ctaggaacgg gagtcatcac gacttatttc gcgtcattat cagcggcggc tgtcgccaaa       300
     gagtcagcac tgtcaaatgg gcagctccgt tatatgcaga aagggcatat catcattgtt       360
     ggatggaacg aacgggctcg cgaagtaata gcaaaacttt cggaatatac ccctcctgtc       420
     cgatgtgtta ttattgatgc cactttaaat gagcttccgg ttccttttaa aaacgttcat       480
     tttataaaag gaaatcctag ctatgacgat gtgcttcata aagcgaacgc caccgaagcg       540
     caaatgattt tgataacggc taatcagcac aaaagcgaag cagacgcaga caaagactct       600
     attttaacat tgctggctgt caaaggcatt catccatcca tatacgcgat tgtggaaata       660
     ttaacagaac agaacgtgaa taacgcaaaa cgagccggtg cggatgaagt gattcaaacc       720
     aatttgctgg caagcttcac gatggcaaac agccttcaat caccgggcgt atccaaagcg       780
     atcatagaat tgctgcacca acttcacggc aaaaaactgc aactgatcgc tgcagaaggc       840
     ccactcatcg gaaaaacgtt tttggaaagc agcgaaatgt tattagacaa acgaatgatt       900
     ttaatcggcg ttatgagaga agaagaagga tatataaacc cttctccgca ttttttgatc       960
     gaaaagggag accgtctgtt cgtaatcacg ccttaa                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page