(data stored in SCRATCH zone)

EMBL: CP002293.PE546

CP002293.PE546       Location/Qualifiers
FT   CDS_pept        597307..597564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0570"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_2851 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73402"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ01"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_2851"
FT                   /protein_id="ADP73402.1"
FT                   /translation="MNVMPIRLFTIQDGEGFVADAFQCPVTGNLIYKSSGTPSVIAYNA
FT                   LTEEQIQYLEKYGFRRMNGASAAAASSPGSSTLEELLPEQ"
     atgaacgtga tgccgattcg tttattcacg attcaagacg gggaagggtt tgtcgcagac        60
     gcgtttcaat gtccggtgac aggcaattta atttacaaat catcaggaac accttctgtg       120
     atcgcataca atgcattaac ggaagaacaa atacaatatt tagaaaaata tggatttcgg       180
     cggatgaacg gcgcttcggc tgcggccgcg tcatctcccg gctcttccac gctggaggag       240
     ttattgccag agcaataa                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page