(data stored in SCRATCH zone)

EMBL: CP002293.PE549

CP002293.PE549       Location/Qualifiers
FT   CDS_pept        complement(600767..602227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0573"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: oih:OB2707
FT                   benzaldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73405"
FT                   /db_xref="GOA:A0A0F6BJ04"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ04"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADP73405.1"
FT                   /translation="MVNFKLLNKQYISGEWKDGTSNRQLIDFNPYNNEVITTFTCASLK
FT                   DVDEAYRSAKEAQKKWQHTNPIEKRAVFENAVKYIEENKESIENIIIDELGGTKLKAAF
FT                   EIDLVINIIKEAATYPFRMEGKILPSPVDGKENRLYRIPVGVVGVISPFNFPFFLSMKS
FT                   VAPALGAGNGVVLKPHEHTPITGGTLIAKIFEEAGLPKGLLNVVITEIEEIGDGFIEHP
FT                   IPKVISFTGSSKVGKHIGEVAGRHLKKVSLELGGNSALIVLDDADIDLAVSAAVFSRFT
FT                   HQGQICMSANRIIVHEKVYDEFLTKYVRKVASLKCGDPRDPETIIGPLMNERQVQMIIN
FT                   LIETGIKEGATPILKGEVKGNIVEPVIFTDVTPDMTIAKEELFGPVVCIMKVENDQQAI
FT                   EYANNSDFGLSGAIHTSNIERGAEMAKQIETGMIHINDGTINDEPIVAFGGEKNSGLGR
FT                   LNGSWSLDAFTTVKWISIQHTPRKYPYS"
     atggtaaatt tcaagttatt aaataagcaa tatatcagtg gagaatggaa agatggcacc        60
     agcaacagac aactgataga ttttaatcca tacaacaatg aagtgattac aacatttaca       120
     tgcgccagct taaaagacgt tgatgaagcc tatcgatcag ccaaagaagc ccaaaaaaag       180
     tggcaacata cgaaccctat tgaaaaaaga gctgtttttg aaaatgcggt aaaatatatt       240
     gaagagaata aagaatctat tgaaaacatc attatcgatg aacttggcgg gacaaaactg       300
     aaagcagctt ttgaaattga tcttgttatc aatataatca aagaagcagc tacatatcct       360
     tttcgaatgg aaggaaaaat tttaccatcc ccagttgatg ggaaagaaaa tcgcctatat       420
     cgcattcctg ttggagttgt cggtgtgatt agtcctttta actttccgtt tttcctttct       480
     atgaaatcgg tcgctcccgc attaggagca ggaaacggtg ttgtgctaaa gccacatgag       540
     catacgccta tcaccggtgg aacgctcatt gccaaaattt ttgaagaagc aggtctgcca       600
     aaaggtctgc taaatgttgt tataactgaa attgaggaaa ttggcgacgg attcattgaa       660
     catccaattc caaaggttat ttcatttaca ggttcaagta aagttggaaa acatatcggt       720
     gaagttgccg gacgtcattt gaaaaaagtc tcattggagc ttggaggaaa tagtgcactg       780
     attgtcctgg atgatgccga tattgatctt gctgtcagtg cagcggtttt cagccgtttt       840
     acacatcaag gccaaatttg tatgtcagcg aatcgaatta tcgttcatga aaaagtatat       900
     gatgaatttt taacaaaata tgtacgtaaa gtagctagtt tgaaatgcgg cgatccacga       960
     gaccctgaga cgattattgg accgttgatg aatgaaagac aagttcaaat gattatcaac      1020
     cttattgaaa caggcataaa agaaggcgca acccctattt taaaaggaga agtgaaggga      1080
     aatattgtag aacccgtcat atttaccgat gttacgccgg atatgacgat tgccaaagaa      1140
     gagctttttg gcccagttgt atgcattatg aaagttgaaa atgaccaaca agcaattgag      1200
     tatgccaaca acagcgattt tggcttaagc ggcgccatcc atacatccaa tattgaacgc      1260
     ggcgcggaga tggcgaaaca gattgaaact ggtatgattc atattaacga cggaaccatc      1320
     aatgatgaac caatagttgc atttggcgga gaaaaaaatt caggattagg acgactcaac      1380
     ggctcatgga gcttagatgc gtttacaact gttaaatgga tttccattca acatacaccg      1440
     agaaaatacc catattcgta a                                                1461
//

If you have problems or comments...

PBIL Back to PBIL home page