(data stored in SCRATCH zone)

EMBL: CP002293.PE551

CP002293.PE551       Location/Qualifiers
FT   CDS_pept        604199..606022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0576"
FT                   /product="amino acid permease"
FT                   /note="KEGG: gwc:GWCH70_1210 amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73407"
FT                   /db_xref="GOA:A0A0F6BJ06"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ06"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_1210"
FT                   /protein_id="ADP73407.1"
FT                   /translation="MFSSLKRFLIGRPLKSTELGEQKLNKLKALAVLSSDALSSVAYGT
FT                   EQILLVLATIGAIAFWYSLPIAIGVLILLMALILSYRQIIYSYPHGGGAYVVSKTNLGV
FT                   NPGLIAGGSLLVDYILTVAVSVSAGTDAITSAFPTLHQYTVGIAIAMVVFITILNLRGI
FT                   NESASVLAYPVYLFVLALVILIIVGIFRIINGQVPSTLHTPVGTAVPGITLFLLLRAFA
FT                   SGCSALTGVEAISNAVPNFKEPAAKNAAKTLVMMGFILAFLFVGVTFLAYWYGIAPKAE
FT                   ETVVSQLASEVFGRSAMYYFIQGATALILILAANTGFSAFPLLAYNLASDKYMPRMYLI
FT                   RGDRLGYSNGIITLGLASILVIVAFNGQTEQLIPLYAVGVFIPFTLSQTGMIVKWVREK
FT                   PTGWVPKLLTNLLGAAITLTVLCIFFITKFTQVWAVLVFLPIIVFIFHQIHKHYDAVAE
FT                   QLRVNPNEIPDKIEGNVVLVPVAGITKVVEQSLNYAQAIGDYVFAVYVAFDRESMLRME
FT                   GKWKKWRPDVRLVTLFSYYRDLITPISKLVDTIESKAEERNYTVTVLIPQFIPKKGWHN
FT                   FLHNQSSVLLRLYLLYKKNVIVSTVPYRLHK"
     atgttttcat cgttaaaacg atttctaatc ggcagaccgt tgaaatcaac cgaactggga        60
     gagcaaaagt tgaacaaatt gaaggcattg gcggttttat cgtctgatgc cctgtcttcg       120
     gttgcatacg gtacggaaca gattttactt gttctcgcaa caattggagc tattgcattt       180
     tggtattccc tccctattgc gattggggtt cttattttat tgatggcact tattttatcg       240
     tatcgccaaa tcatttactc ttatccacat gggggcgggg cttacgtcgt ttccaaaaca       300
     aatttgggtg ttaatcctgg cctcattgcc ggaggctctt tgctggtcga ctatatttta       360
     acggtggcgg taagtgtgtc cgcgggaaca gatgccatta catccgcatt tccaacttta       420
     catcaataca cagttggaat tgctatcgcc atggttgtgt ttatcactat tcttaatctt       480
     aggggcataa acgaatccgc ttctgtttta gcgtatcccg tttatttgtt tgtgttggca       540
     cttgttattc tcattattgt tgggattttc cgaattataa atggccaagt gccgtcaact       600
     ttgcatacac ctgtcggtac tgcagtgccc ggaattacgt tatttttatt actgcgcgct       660
     tttgcatccg gctgttctgc attgacaggg gtagaagcga tctccaacgc tgttccaaat       720
     tttaaggaac cggcggcaaa aaacgctgcc aaaacgttag tgatgatggg attcatcctc       780
     gcttttctat ttgttggagt cactttttta gcatactggt atggaattgc tccgaaagca       840
     gaagaaactg ttgtttccca acttgcttct gaggtgtttg gaagaagcgc gatgtattac       900
     tttatccaag gagcaactgc ccttatttta attttggctg caaatacggg gttttctgcc       960
     tttcctttgc tggcatataa tctcgcatcc gataaataca tgccaagaat gtatcttata      1020
     cgtggcgacc gattaggata ttcaaacgga atcatcacgc ttggccttgc ttctattttg      1080
     gtgattgttg cttttaatgg gcagacggaa cagttaatcc ctttgtatgc agttggcgta      1140
     tttattcctt tcactttgtc acaaacagga atgattgtaa aatgggtgcg cgaaaaacca      1200
     acagggtggg taccaaagct gcttacaaac ttgttaggag ctgccattac actaaccgta      1260
     ctgtgcatct tttttatcac aaaatttact caagtatggg ctgtgcttgt ctttcttccg      1320
     attatcgtat ttatttttca tcaaatccat aagcactatg atgccgtggc agagcaactg      1380
     cgcgtcaatc caaacgagat tcccgacaaa attgagggaa atgtcgtgct tgtgcctgtt      1440
     gcgggaataa caaaggtagt cgagcaatcc ttaaattacg cccaagccat tggagattac      1500
     gtattcgctg tatatgtggc ctttgatcgg gaaagcatgc ttcgaatgga agggaaatgg      1560
     aaaaagtggc gcccggatgt tcggcttgtt accctctttt cttattatcg cgatcttatc      1620
     acaccaattt ccaagctggt ggataccatt gaaagcaagg cggaggaaag aaactataca      1680
     gtaacagttt tgattcctca atttataccg aaaaagggat ggcataactt tttgcataac      1740
     caatccagcg ttttattgcg cttgtacctt ctatataaga aaaatgtgat tgtctcaaca      1800
     gttccttacc ggctccacaa gtag                                             1824
//

If you have problems or comments...

PBIL Back to PBIL home page