(data stored in ACNUC7421 zone)

EMBL: CP002293.PE552

CP002293.PE552       Location/Qualifiers
FT   CDS_pept        606529..607299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0577"
FT                   /product="Threonyl/alanyl tRNA synthetase SAD"
FT                   /note="PFAM: Threonyl/alanyl tRNA synthetase SAD;
FT                   Alanyl-tRNA synthetase, class IIc-like; KEGG:
FT                   bcy:Bcer98_0478 threonyl/alanyl tRNA synthetase SAD"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73408"
FT                   /db_xref="GOA:A0A0F6BJ07"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ07"
FT                   /inference="protein motif:PFAM:PF07973"
FT                   /protein_id="ADP73408.1"
FT                   /translation="MTRELFLEDSYKKAHHAKVIEIKEDKIILDETIFYPTGGGQPHDT
FT                   GMIKQGNETFKVNKVQRENGQIVHYVDNIEKLKQGPVEILIDWDRRYKFMRYHSLLHVL
FT                   AGYLYNKFGALAIGNQIFEDRARIDFQFEEPLTNEQFNEIEDEINKLIQEDHQVSIRTV
FT                   SREEAERIDGSIKTVINLLPPSIKNVRLVAIGDIDEQACGGTHVKETKEIGPFQISKIK
FT                   SKGQNKKRLEVKSKLLCKFPFDRKHGPDDLTYGR"
     atgacaagag aacttttctt agaagacagt tataaaaaag cacatcatgc taaagtcatc        60
     gaaattaagg aggacaaaat tattttagac gagacgattt tctaccccac aggtggcggc       120
     caacctcatg atacaggaat gatcaaacaa ggaaatgaga catttaaagt gaataaggtt       180
     caaagagaaa atggacaaat tgtccattat gtagacaata ttgaaaaact aaaacaaggt       240
     cctgtagaga tactgataga ctgggatcga cgatataaat ttatgcgtta tcattccctg       300
     ttacatgtat tagccggtta tctttataac aaattcgggg ctttggcgat aggaaatcaa       360
     attttcgagg atcgggcaag aatcgatttt caattcgaag aacctttaac aaacgaacaa       420
     tttaacgaga ttgaagatga aataaacaag ttaatccaag aggatcatca agtctcaata       480
     cgcaccgtta gccgtgaaga agcggagaga attgacggtt ctattaagac ggtgattaat       540
     ttgctgcctc cttctattaa aaatgtccga cttgttgcta ttggtgacat tgatgaacag       600
     gcttgcgggg gaacacatgt aaaagaaaca aaagaaatag gcccttttca aatttcgaaa       660
     atcaaaagta aaggacaaaa caaaaaacgc ttagaggtca agtccaaatt attgtgtaaa       720
     ttcccctttg atagaaaaca tggacctgat gacttgacgt atggtaggta a                771
//

If you have problems or comments...

PBIL Back to PBIL home page