(data stored in ACNUC7421 zone)

EMBL: CP002293.PE553

CP002293.PE553       Location/Qualifiers
FT   CDS_pept        complement(607434..608669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0578"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG:
FT                   gwc:GWCH70_1766 transposase mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73409"
FT                   /db_xref="GOA:A0A0F6BLG8"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BLG8"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ADP73409.1"
FT                   /translation="MAQYHITLNDELLHGLFTRDEGLAKLLEQVLNQILEAQVEEQLGA
FT                   RRYERTEERKGYRNGSYPRQLTTRVGRLTLRVPRTRDGEFSTELFQRYQRSEQALVLAL
FT                   MEMVVNGVSTRKITQITEELCGTSFSKSTVSSLCKGLDPIIQDWNYRSLHEHVYPFVLV
FT                   DAIYTKVREDGRVRSRAVLIATGVNEEGYREILGLQIGNSESESSWSEFFGWLKDRGLR
FT                   GVDLIISDQHGGLVQAIEKHFQGATWQRCQTHFIRNILDAAPKYMQDALLEEIRGILHA
FT                   PNKQTARLLLEQVLAKWEEKAPKAMQILEEGFEDATAVLDYPDRYRRRLRTTNGVERLN
FT                   EEIRRRERVIRIFPNRESVYRLVGAVLIEIDEKWMSGRKYLDMSEYWRWRKMKEQGVRS
FT                   VNQEAPAIKRVG"
     atggctcaat atcatattac cctaaatgat gaacttttgc acgggttatt caccagagat        60
     gagggattag ctaagctatt ggaacaagtc ctcaatcaaa tcctcgaggc acaagtagaa       120
     gaacagctgg gagctcgccg ttatgaacga acggaagaac gaaaaggcta tcgaaacggt       180
     tcgtatccac gccagctgac gacccgggtg ggacggttga ccttgcgcgt tccacggaca       240
     agagatgggg agttctctac ggaactgttc caacggtatc aacggagcga acaagcactg       300
     gtactggcac taatggaaat ggtggtaaac ggggtgtcta cccgaaaaat cactcaaatc       360
     acggaggaat tatgcggcac ttcgttttcc aagtccacgg tctcctcact gtgcaaggga       420
     ctggatccga ttatccaaga ctggaattat cgttcccttc atgaacacgt gtatccgttt       480
     gtgctagtag atgctattta tacgaaagtc cgggaggatg gacgagtacg ctccagagcc       540
     gtgttgatcg ctacaggagt gaatgaggaa ggatatcgag aaattcttgg cctgcaaatc       600
     ggaaacagtg aatcggagtc cagctggagc gagttcttcg gatggctgaa agaccgggga       660
     ctccggggag tggacttgat catctcggat cagcacggtg ggctggtgca agccattgaa       720
     aagcatttcc aaggcgctac atggcaacga tgccagacac attttattcg caatatcctc       780
     gatgccgcac caaagtatat gcaggatgcc ttgctcgagg agattcgtgg gattcttcat       840
     gctccaaata agcaaacggc ccggctgtta ttggaacaag tgctggccaa atgggaagaa       900
     aaagctccaa aagccatgca aatcctcgaa gagggattcg aagacgccac cgccgtattg       960
     gactatccgg accgttatcg tcggcgtctg cgcacgacca acggagtgga acggctgaac      1020
     gaggaaatcc gccgcagaga acgggtcatc cgcatctttc cgaaccggga atcggtgtat      1080
     cgcctcgttg gcgccgtgtt gatcgaaatc gacgaaaaat ggatgtcagg gcgcaaatac      1140
     ttggatatgt ccgaatattg gcggtggcgg aaaatgaaag agcaaggagt ccgatcggtg      1200
     aatcaggagg ctccggcgat caagagagtg ggataa                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page