(data stored in SCRATCH zone)

EMBL: CP002293.PE555

CP002293.PE555       Location/Qualifiers
FT   CDS_pept        complement(610196..611395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0581"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: gtn:GTNG_0752
FT                   DNA integration/recombination/invertion protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73411"
FT                   /db_xref="GOA:A0A0F6BJ10"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ10"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADP73411.1"
FT                   /translation="MASIQRRGKSSFLLVVEAGYDAKGKRLRRTKTIRIEDEALLKTTK
FT                   KLRDYLNEELLKFKMEVEAGEYIAPEKMKLADFIKEWETKYAVKELSETTLNNYLSHIK
FT                   NHILPALGHMRIDQIKPVHIVNFLDQIKRADGKKKPLATRTIENAYLTIRNILQRAVEW
FT                   QIIKSNPASAVKKPKSKKEAVKEVQVYDEKEVEALFRAVQNEPFHWRIFTTLAIAAGLR
FT                   RGELLALEWSNIDLEKGVIRINKAIVKGRKRSVEKSPKTKKSNRLVSLPKSVVAELKLY
FT                   RRHWLKQKLQAGDLWKEEKEYLFCNIDGRHFYPTTPTTWWRRFTKRAGIRYIRLHDLRH
FT                   TSATLLINQGVHAKIIAERLGHSDIRVTMDIYGHALQKADHEAANKLDHLFTNTSSQMK
FT                   "
     gtggcgagca ttcaacgtcg agggaagagt tcattcttgt tggtagtgga agctggctat        60
     gatgccaagg gaaaacggct tcgacgtacc aaaacgattc gcatcgagga tgaggctttg       120
     cttaagacaa ctaaaaagct ccgcgattat ttgaatgagg aattgctgaa attcaagatg       180
     gaagtcgaag ctggcgaata catcgctcct gaaaaaatga aattagccga ttttattaaa       240
     gagtgggaaa ccaaatacgc ggtaaaagaa ctatcggaaa caaccttgaa taattattta       300
     tcccatatca aaaaccacat cctccccgct ctcggacata tgcgaatcga tcagattaag       360
     ccagttcata ttgtaaactt tttagaccag atcaaaagag cagacggcaa aaagaagcca       420
     cttgcaacaa gaacaatcga aaatgcctat ctaaccatta gaaatattct tcaacgagct       480
     gtcgaatggc aaatcattaa atccaatccg gccagcgcag tcaaaaagcc gaaaagcaag       540
     aaagaagctg ttaaagaagt tcaagtatac gacgaaaaag aagttgaagc tctgtttcgg       600
     gcagtgcaaa acgaaccttt tcattggagg atttttacga cattggcgat cgccgcaggt       660
     ttgcgaagag gagaactatt agcccttgag tggtcaaata ttgatttgga aaagggcgtt       720
     atccgtatta ataaagccat tgtgaaaggg cgaaaaagat cggtggaaaa aagcccaaaa       780
     accaaaaaat ctaatcggct tgtttcccta ccgaaatccg ttgttgctga actcaaatta       840
     taccgccggc actggctaaa acaaaaactg caggcgggag acttatggaa ggaagaaaaa       900
     gagtacttat tttgcaatat cgatggtcgg cacttttatc cgaccactcc taccacctgg       960
     tggcggcgtt ttacaaagcg tgctggcatc cgctatattc gtcttcacga tcttcgtcat      1020
     acttcggcca ctttattaat taaccaagga gtgcacgcaa aaattattgc cgaacggctc      1080
     ggccattcgg atattcgagt gaccatggac atatacgggc atgcactcca aaaagcagac      1140
     catgaagcag cgaataaact tgatcattta tttacaaaca cgtcatcaca gatgaaataa      1200
//

If you have problems or comments...

PBIL Back to PBIL home page