(data stored in SCRATCH zone)

EMBL: CP002293.PE556

CP002293.PE556       Location/Qualifiers
FT   CDS_pept        complement(611426..611575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0582"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcy:Bcer98_2627 phage integrase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73412"
FT                   /db_xref="InterPro:IPR028259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ11"
FT                   /inference="similar to AA sequence:KEGG:Bcer98_2627"
FT                   /protein_id="ADP73412.1"
FT                   /translation="MAYFRKVKAKNKKGYTWSFTIDIGTGKRKQITRRGFESFYFYENL
FT                   IAEN"
     atggcctatt tccgaaaagt aaaagcgaaa aacaaaaaag gatatacatg gtcttttacg        60
     atagatatcg gaacagggaa acgaaaacaa atcacacgac gcggctttga aagtttttat       120
     ttttacgaaa atctgatcgc tgaaaactaa                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page