(data stored in ACNUC7421 zone)

EMBL: CP002293.PE557

CP002293.PE557       Location/Qualifiers
FT   CDS_pept        complement(611663..612178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0583"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: protein of unknown function DUF955; KEGG:
FT                   bbe:BBR47_35830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73413"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ12"
FT                   /inference="protein motif:PFAM:PF06114"
FT                   /protein_id="ADP73413.1"
FT                   /translation="MELHRYYTTALEDWVTRFYTRLKIFRPEDISPLIISRKLGIFLRE
FT                   RPFPSTHQVVGRFRCIVVDSRLSKEKKREAFFHELCHILRHVGIQSMMPEAFRELQERD
FT                   ATHFTKYAAIPFHMLKLIDWHEPYIVEHMSNMFKVTPELCEERLTQIRNRILVKQSSNE
FT                   TKISTFQR"
     atggaactac accgctacta cacgaccgcg ttggaggatt gggtgactag gttttataca        60
     agactaaaga tttttcgtcc agaagatatt agtccgttaa taatttcaag aaaattaggc       120
     attttccttc gcgaaaggcc gttcccttca acacatcaag ttgtgggtcg ctttcgctgc       180
     attgttgtcg actcccgact atctaaagaa aaaaaacgcg aagccttttt tcatgaattg       240
     tgtcacatat tgaggcacgt tggtatacag agtatgatgc cggaggcttt tcgtgagttg       300
     caagagcgag acgcaactca tttcactaaa tatgctgcta tcccttttca tatgttaaaa       360
     ctcattgact ggcacgagcc atacatagtt gagcatatgt ctaatatgtt taaagtgaca       420
     ccagagttat gtgaagaacg cttaacacag attagaaacc gtatattagt caaacaatcg       480
     agtaatgaaa ctaaaattag cacattccaa aggtag                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page