(data stored in ACNUC7421 zone)

EMBL: CP002293.PE56

CP002293.PE56        Location/Qualifiers
FT   CDS_pept        68012..68317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0056"
FT                   /product="sporulation protein YabP"
FT                   /note="KEGG: gwc:GWCH70_0055 sporulation protein YabP;
FT                   TIGRFAM: sporulation protein YabP; PFAM: YabP family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72912"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHL1"
FT                   /inference="protein motif:TFAM:TIGR02892"
FT                   /protein_id="ADP72912.1"
FT                   /translation="MSQHYDFGGNTNKGPVQEHDVIMRGRRLLDITGVKQVESFDNEEF
FT                   LLETVMGFLSIRGQNLQMKNLDVDKGVVSIKGRIFDLVYLDDHQEKAKGFFSKLFK"
     atgagccaac attatgattt tggaggcaac acaaacaaag gtcctgtcca agaacatgat        60
     gtcattatgc gggggagaag gcttcttgac attacgggag tcaaacaagt ggaaagcttt       120
     gataatgagg aatttttgct ggaaacagtg atgggctttt tgtcgatccg cgggcaaaat       180
     ttgcaaatga aaaacttaga cgtggataaa ggggtcgttt ccattaaagg gagaattttt       240
     gaccttgtgt atttagatga ccatcaggag aaggctaaag gattctttag caagttgttc       300
     aaatga                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page