(data stored in ACNUC7421 zone)

EMBL: CP002293.PE560

CP002293.PE560       Location/Qualifiers
FT   CDS_pept        complement(615742..617334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0587"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lmo:lmo1118 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73416"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ15"
FT                   /inference="similar to AA sequence:KEGG:lmo1118"
FT                   /protein_id="ADP73416.1"
FT                   /translation="MAYEIKTIDIDKIIVNVLNPRYEPQESELKEMDLIINNGKIIELI
FT                   KDIAQYGLDPSENLIVSYDKELDAYISEEGNRRITAIKILNDPDLIPSFTKNRDKLINQ
FT                   VKKIKEKARYSYIKEVNCVIIDDEDTKHHFIELKHTGENKGAGRVRWNTESQARFRSTD
FT                   KFREHLLKFLKSIHPEIKDSFGLTTVERIISDPDMRDAIGLTIDKKNQEIKLINDNSKQ
FT                   KLYFILDGLLTKKFNVNTFRHKEDRQKFAQDYLLNDEHQPWKELYIEAIKNNQTTKNNE
FT                   KIVPTQDNLNQDYYKESNSQKDLPNRNDRDKGNPNQNDRNQGNSDKNNSNKDESFIDIS
FT                   NQTSENKNNNGRKTSGRPPKDIRDFDILTKAIPFKNQYRKNKRINQILKEMSQINYKEN
FT                   PISSMYLIRSILETYVHKYIDYFASLDRHHPYKMKNIPPQRDKRRKELKNLIYEDIYNH
FT                   LKNVIQDYADTYELIRVTFTDNNQASAMQIINYYIHSGTDYPDSIELLEAWNKISTIIK
FT                   TLDELLAKHADQK"
     atggcttatg aaatcaaaac aattgacatt gataaaataa ttgtcaatgt attaaatcca        60
     agatatgaac ctcaagaaag cgaattaaaa gagatggatc tgataataaa caatggaaaa       120
     atcatagaat taattaagga catcgctcag tatggattgg atccaagtga aaacttaatt       180
     gtttcttatg acaaagaatt agatgcatat atctccgaag agggaaatag aaggataaca       240
     gcaatcaaaa ttttaaatga cccagactta atcccttcct ttacaaaaaa ccgtgataag       300
     ctcataaacc aagttaaaaa aataaaagaa aaagcccgtt atagttatat aaaggaggtt       360
     aattgcgtta ttattgatga tgaagatact aaacatcatt tcattgagtt aaaacatact       420
     ggtgagaata agggtgcagg aagagttaga tggaatacag aaagtcaagc aagatttaga       480
     tcaacagaca aattcagaga acatttactt aagtttctaa aaagtattca tcccgagatt       540
     aaagatagct ttggtttaac aacggtagaa agaattatat ctgatccaga tatgagagat       600
     gccattggtt taaccattga caaaaaaaat caagaaatca aattaattaa cgataattcg       660
     aaacaaaaat tgtactttat attggatggg cttttaacca aaaaatttaa tgtaaatacc       720
     tttcgtcata aagaagacag acaaaaattt gctcaagact atttattaaa cgatgaacat       780
     cagccatgga aagaattata cattgaagca attaaaaata accaaactac taaaaataac       840
     gaaaaaatag ttcctactca ggataactta aatcaagatt attataaaga gagtaattct       900
     cagaaggatc tccctaatcg aaatgatcgg gataaaggaa atccaaatca aaatgatcga       960
     aaccaaggca attctgataa gaacaattcc aataaagatg agtctttcat agacatctct      1020
     aatcaaacat cagaaaataa aaataataat ggtagaaaaa cttctggccg tccccctaaa      1080
     gacattagag attttgatat tttaactaag gcaatacctt ttaaaaacca atatcgtaag      1140
     aataaaagaa ttaatcagat cttaaaagaa atgtcccaaa taaattataa agaaaaccct      1200
     atttcttcga tgtatttaat tagaagtata cttgaaacat atgtacacaa atatatagat      1260
     tatttcgctt cactagatcg tcatcatcca tataaaatga aaaatattcc ccctcagcga      1320
     gacaaaagaa gaaaagaact gaagaattta atatatgagg atatatacaa ccacctaaaa      1380
     aatgtaatac aggattatgc ggacacttat gaattaattc gtgttacttt tacagataat      1440
     aatcaggctt cggcaatgca aattatcaat tattacattc attctggtac tgattatcct      1500
     gactcgatag aattattaga agcatggaat aagatttcaa ctattattaa gacactcgat      1560
     gaattattag caaaacatgc tgaccaaaag taa                                   1593
//

If you have problems or comments...

PBIL Back to PBIL home page