(data stored in SCRATCH zone)

EMBL: CP002293.PE561

CP002293.PE561       Location/Qualifiers
FT   CDS_pept        complement(617995..618441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0589"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: cth:Cthe_2460 XRE family transcriptional
FT                   regulator; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73417"
FT                   /db_xref="GOA:A0A0F6BJ16"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ16"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADP73417.1"
FT                   /translation="MNILGKRLKYLREKFNYSQKKVAEAIGISNVQLSRYESGDRNPDP
FT                   ELIAAFADFYGVTTDYILGRTDDPQGYAPETNIDNIKDTKELNTLIKINELIKKYGIEQ
FT                   MGFFDIEKWKSLSEEEIEEIIKHFEWVVHKAKEKNKAAREGTED"
     atgaatattt tgggaaaacg cctaaaatat ctaagagaaa aatttaatta ttcccaaaag        60
     aaagttgctg aagctattgg tatatccaat gttcaattat ccagatatga atccggggac       120
     cgaaatccag acccagaact gattgcagcg tttgctgact tttacggtgt aaccaccgat       180
     tatatccttg gtcgtacaga tgatcctcaa ggctatgctc cagaaaccaa tatagacaac       240
     ataaaggata caaaagagct gaacaccctt atcaaaatta acgaacttat taaaaaatac       300
     ggcattgaac aaatgggctt cttcgatatt gagaaatgga aaagcctatc ggaggaagag       360
     atcgaggaga tcataaagca cttcgagtgg gttgttcata aagcaaaaga aaagaataaa       420
     gcagcaagag aaggcaccga agactaa                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page