(data stored in SCRATCH zone)

EMBL: CP002293.PE562

CP002293.PE562       Location/Qualifiers
FT   CDS_pept        618628..618861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0590"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: tte:TTE2124 helix-turn-helix; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73418"
FT                   /db_xref="GOA:A0A0F6BJ17"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ17"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADP73418.1"
FT                   /translation="MKNKQVDLEKIKKLRKEANISLEKMAELLGYESPNGYYYLETGRV
FT                   KFPADKLAVVSEILNVPIDQLFFEVNFAKMAK"
     ttgaaaaata aacaagtcga tttagagaaa ataaagaaac ttcgtaagga agcaaatata        60
     tctttggaaa aaatggctga attgcttgga tatgaaagtc ccaatggata ttactatctt       120
     gaaactggga gagttaaatt tccagccgat aagttagctg ttgtttcaga aattctcaac       180
     gtgccaatcg atcaactttt ttttgaagtt aattttgcca aaatggcaaa ataa             234
//

If you have problems or comments...

PBIL Back to PBIL home page