(data stored in SCRATCH zone)

EMBL: CP002293.PE563

CP002293.PE563       Location/Qualifiers
FT   CDS_pept        618910..619215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0591"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK0497 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ18"
FT                   /inference="similar to AA sequence:KEGG:GK0497"
FT                   /protein_id="ADP73419.1"
FT                   /translation="MNLEQRLSELEARVSQLEKEAAAATTAETEKHLNDLPNSTKEIIQ
FT                   KEIEKAKQSELIVGIDPESYLAKEILWQSRKMIELENSVSKISSSINRLKRLLSKS"
     atgaatctcg aacaacgtct ttctgaatta gaagcacgtg tttctcagct tgaaaaagaa        60
     gccgccgcgg caacgacggc tgaaacagaa aaacatttga atgatttacc aaactcaaca       120
     aaagaaatta tccagaaaga aatcgaaaaa gcaaaacaaa gtgaattgat tgttggcata       180
     gatccagaaa gttatttggc aaaagaaatc ttatggcagt ctagaaaaat gatagagcta       240
     gaaaattcgg tatcaaaaat atctagcagc attaatcgct taaaacgatt gttatcaaag       300
     tcataa                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page