(data stored in ACNUC7421 zone)

EMBL: CP002293.PE564

CP002293.PE564       Location/Qualifiers
FT   CDS_pept        complement(619222..619590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0592"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK0498 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ19"
FT                   /inference="similar to AA sequence:KEGG:GK0498"
FT                   /protein_id="ADP73420.1"
FT                   /translation="MNDNFEHQLKTISFLISEGFNAAKYCHELIFAEDRKNNINLALTF
FT                   LNQANTFITSAKAIYVQFSLEGESQELEDFFHQFSVFNKEVLTNVRTGHSHQWSDIEFR
FT                   RLEKEFNALTDFLNIWRK"
     atgaatgata attttgagca tcagttaaaa accattagct ttctgatttc cgaaggattt        60
     aatgctgcta aatactgtca cgaattaata tttgctgagg atagaaagaa caatatcaac       120
     ttagcactta catttttaaa tcaggctaat acatttatca cttcagcaaa ggcgatatat       180
     gttcaatttt ctttggaagg cgagagtcaa gaactagaag acttttttca ccaattcagt       240
     gtatttaata aagaagtgct gactaatgtt agaactggcc atagtcatca atggtcggat       300
     attgaattta gacgattaga aaaagaattt aatgcgttaa cagatttttt gaacatttgg       360
     aggaagtaa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page