(data stored in ACNUC7421 zone)

EMBL: CP002293.PE565

CP002293.PE565       Location/Qualifiers
FT   CDS_pept        619661..619846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0593"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="KEGG: oih:OB3324 hypothetical protein; TIGRFAM: DNA
FT                   binding domain protein, excisionase family; PFAM: Prophage
FT                   CP4-57 regulatory"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73421"
FT                   /db_xref="GOA:A0A0F6BJ20"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ20"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ADP73421.1"
FT                   /translation="MERKTLTVQEVAEYLGVHRDTIYAMVRQKQIPHFRIRRRILFSRE
FT                   AIDAWIREQESTIVAM"
     atggaacgca aaacgcttac tgtccaggag gtagctgaat atctcggtgt tcatcgcgac        60
     acgatttatg cgatggtgcg tcaaaagcaa atccctcatt ttcgaatccg acgccgtatt       120
     ttattcagtc gtgaagcgat tgatgcgtgg atccgagaac aagaatctac gattgtggcg       180
     atgtaa                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page