(data stored in ACNUC7421 zone)

EMBL: CP002293.PE57

CP002293.PE57        Location/Qualifiers
FT   CDS_pept        68314..68925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0057"
FT                   /product="spore cortex biosynthesis protein YabQ"
FT                   /note="KEGG: gwc:GWCH70_0056 spore cortex biosynthesis
FT                   protein YabQ; TIGRFAM: spore cortex biosynthesis protein
FT                   YabQ; PFAM: Spore cortex biosynthesis protein, YabQ-like"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72913"
FT                   /db_xref="GOA:A0A0F6BHL2"
FT                   /db_xref="InterPro:IPR014242"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHL2"
FT                   /inference="protein motif:TFAM:TIGR02893"
FT                   /protein_id="ADP72913.1"
FT                   /translation="MSVTTQLATMLAMIGMGSWLGAALDTYNRFLQRQNRKHWVVFIND
FT                   VLFWIVQGLIIFYVLLLVNEGELRFYIFLAVLCGYAAYQSLFRMIYLRVLEWVISLAVR
FT                   LYRFFIRLCYYLIVRPVQLLLQTLLMLSLFIWNVFLFVLRILYQCVKILFAPVRWIGFM
FT                   VWRRIPQNWKKTLKNFFRYLAGIIRPVKNMIVKWVLKWRK"
     atgagtgtga caacgcagct ggcgacaatg ctggcgatga ttgggatggg cagctggctt        60
     ggtgccgcgc tggatacgta taatcgcttt ttacagcggc agaaccgcaa gcattgggtt       120
     gtgtttatca atgacgtttt gttttggatt gtgcaaggac ttatcatttt ttacgttttg       180
     ctgctcgtca atgaaggcga gctgcgcttt tacatttttt tagcggtttt atgcggatat       240
     gccgcttatc aaagtttgtt tcgtatgata tatttaaggg tgctcgaatg ggtgatttcg       300
     ctcgcggtgc ggctgtaccg ctttttcatc cgcttatgct attacttgat tgttcggccg       360
     gttcagctgc ttttgcaaac attactcatg ctttcgcttt ttatatggaa tgtgtttctc       420
     tttgttcttc gcattttgta ccaatgtgtt aagatattgt ttgctccggt ccgctggatc       480
     ggttttatgg tttggcgaag aattccgcaa aattggaaaa agacgctgaa aaattttttc       540
     cgctatttag caggaattat ccgcccggtg aagaatatga ttgtcaaatg ggtgctaaaa       600
     tggcgaaaat aa                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page