(data stored in ACNUC7421 zone)

EMBL: CP002293.PE61

CP002293.PE61        Location/Qualifiers
FT   CDS_pept        72332..74809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0061"
FT                   /product="stage II sporulation protein E, protein
FT                   serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="SMART: protein phosphatase 2C domain protein;
FT                   TIGRFAM: stage II sporulation protein E; KEGG:
FT                   gwc:GWCH70_0059 stage II sporulation protein E, protein
FT                   serine/threonine phosphatase; PFAM: Stage II sporulation
FT                   protein E"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72917"
FT                   /db_xref="GOA:A0A0F6BHL6"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHL6"
FT                   /inference="protein motif:TFAM:TIGR02865"
FT                   /protein_id="ADP72917.1"
FT                   /translation="MERVEKRWMNRISEMSINETQAVLSRWVRHVKLRIGHLFIHKGFL
FT                   LFIIGFLLGRALILSKLTPFALPFFAAVYMLRRDKAALAFVALLAGSLTLSLTTTLFIF
FT                   IGIFSFLIVNAFLRKFFSESIKIVPLIIFCLSFFAKLAILRYFLKNETLYEAVMAFVEA
FT                   GLAFVLTLIFIQSIPLLAVRKHKQALRAEEIISLIILIASMLTGMIGWTFYGLSLEHVM
FT                   SRYLVLIFALVAGATIGPTVGVVTGLILSLANVGNLYEMSLLAFAGLLGGLLKEGKKAG
FT                   ASFGLLVATLLIGLYGNGKAEIVPTVMESCLAIILFICTPRSLTETIAKHIPGTVEYAN
FT                   EQQQYARKIRDVTAQRVSQFSHVFQALANSFSTDSFTSSEDYNEREIDYFLSDIAGKTC
FT                   QTCFKKEQCWSAHFDTTYEYMKKIMLEADAGKLEHNRKLLREWDRHCVKANKVVGMIEK
FT                   DVTLYRANRKVRKQMNESRKMVAEQLLGVSQVMEDFAKEIQRERENHYLQEEQIFHALQ
FT                   EFGIEIGHIDIYSLEKGNIDIEMSVPYCEGRGECEKLIAPMLSDILGETIVVKREECAV
FT                   YPNGYCRVAFGSARAFVVETGVAFAAKGGGLVSGDSYSMIELGTGKYAIAISDGMGNGE
FT                   RAHHESNETLRLLQKILQTGMDESIAIKSVNSILSLRTTEDMFSTLDLAMIDLQNAVTK
FT                   FLKIGSAPSFIKRGDKVMKIEASNLPIGIIKEVEFEIVSEQLKAGDLLIMMSDGVFEGP
FT                   PHVENHDLWMKRKIKELKTNDPQAVADLIMEEVIRSRSGRIEDDMTVVVAKINHNTPKW
FT                   ATIPAYMYTKKAQ"
     atggaaagag tagaaaaaag atggatgaat cgaatttcgg aaatgtctat taatgagacg        60
     caagcggtgt tgtcgcgatg ggtgcgccac gtgaaattgc gaatcgggca cttatttatt       120
     cacaaagggt ttcttctttt tattattggt tttttgcttg gacgagccct tattttatcc       180
     aagctaactc cgtttgcttt gccgttcttt gccgctgttt acatgttgcg ccgcgataag       240
     gcggcattag catttgttgc gttgcttgcg ggttcgctta ccctgtcatt gacgacaacg       300
     ttatttattt ttatcggcat cttcagtttt cttattgtca acgccttttt gcgaaagttt       360
     tttagtgaat cgatcaaaat cgtgcctttg atcatatttt gtttatcatt tttcgcaaaa       420
     ttggcaattc tgcgttattt tttgaaaaac gagacgttat atgaagcggt gatggcgttt       480
     gtcgaagcag ggctcgcatt tgtactgacc cttattttta tccaaagtat tccgctgctg       540
     gcagttcgta aacataaaca agcgctgcgc gcggaagaaa ttatttcact tattatttta       600
     attgcgtcca tgttgacggg gatgatcggt tggacgtttt atggactttc acttgaacat       660
     gtgatgtctc gctatctcgt gttaattttt gcgctcgtgg cgggggcgac gattggccct       720
     accgtcggag tggtgacagg gcttatttta agtttggcga acgtcggtaa tttgtacgaa       780
     atgagcttgt tggcgtttgc cggcctttta ggaggtttgc ttaaggaagg aaagaaagcc       840
     ggcgcctctt tcgggctgct tgtcgcgaca ttgctgatcg gtttatacgg aaacggtaag       900
     gcggaaattg tcccgacggt gatggagtcg tgcttggcga ttattttatt tatatgtaca       960
     cctcgttcat taacggaaac aatcgcaaaa catatccccg gtactgtaga atatgccaat      1020
     gaacagcagc aatatgccag aaaaattcgc gatgtgacgg cacagcgcgt ttcgcaattt      1080
     tcccacgtgt ttcaggcgct ggccaatagc ttttcgacag acagcttcac ttcttcggaa      1140
     gattacaatg agcgggagat tgattatttt ttaagcgaca ttgcgggaaa aacgtgccaa      1200
     acttgcttta aaaaagagca atgctggtcc gcccattttg atacaacata tgaatatatg      1260
     aagaaaataa tgctagaagc ggatgcggga aaattagaac ataaccgcaa actattgcgg      1320
     gaatgggacc gccattgcgt aaaagcgaac aaagtagtcg gcatgattga aaaagatgta      1380
     acactttatc gggcaaatcg caaagtgcgc aaacaaatga atgaaagcag aaagatggtt      1440
     gccgaacaac tgttaggtgt ctcacaggtg atggaagatt ttgcaaagga aattcagcgt      1500
     gaacgcgaaa atcattattt acaggaggaa caaatttttc acgccttgca ggagtttggg      1560
     attgaaatcg gccatattga catttacagc ttggaaaaag gaaatatcga tattgagatg      1620
     agcgttccat attgcgaagg ccgcggcgaa tgtgaaaaat tgattgcgcc aatgctgtcg      1680
     gatattttag gagaaacgat cgtggtaaaa cgggaagaat gcgctgttta cccgaacggc      1740
     tattgccggg tggcattcgg ttcggcgaga gcgttcgtcg tcgaaacggg cgtggcgttt      1800
     gcggcgaaag gaggcgggct tgtttcaggg gatagctatt cgatgattga acttggaaca      1860
     ggaaagtatg cgattgcgat cagcgatgga atgggaaacg gagaacgcgc acaccacgaa      1920
     agcaatgaga cgctgcgtct tttgcaaaag attttgcaga cagggatgga tgaatcgatc      1980
     gccataaaat ccgtcaattc cattttatca ttgcggacga cggaagatat gttttccacg      2040
     ctagatttag ccatgattga tttgcaaaac gccgtaacaa aatttttaaa aatcggctcc      2100
     gcgccgagct ttatcaaacg cggcgataaa gtcatgaaaa tcgaggcgag caatttgccg      2160
     atcggaatca ttaaagaagt ggaatttgag attgtcagtg aacaattaaa ggcgggcgat      2220
     ttgcttatta tgatgagcga cggggtgttc gaagggccgc cgcacgtgga aaatcatgat      2280
     ctatggatga agcggaaaat taaagaattg aaaacgaacg acccgcaggc agtggcggat      2340
     ttaatcatgg aggaagtaat ccgaagccgt tccgggagaa ttgaagacga catgacggta      2400
     gtcgttgcga aaatcaatca taatacgcca aaatgggcga cgattccagc ctatatgtat      2460
     acaaaaaaag cgcaataa                                                    2478
//

If you have problems or comments...

PBIL Back to PBIL home page