(data stored in ACNUC7421 zone)

EMBL: CP002293.PE63

CP002293.PE63        Location/Qualifiers
FT   CDS_pept        75575..76552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0063"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine-protein kinase-like domain;
FT                   KEGG: gwc:GWCH70_0061 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72919"
FT                   /db_xref="GOA:A0A0F6BHL8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHL8"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADP72919.1"
FT                   /translation="MMNHTLKGLCNLPAGTVITGKWHHQSYKLLKPLGHGANGAVYLAE
FT                   SAKGIVALKLSDNSEAVTSEVNVLRRFSKVQGVALGPSLLDVDDWAAPLMKKHISFYVM
FT                   EYIRGEDFSTFIRKHGKEWVAILLLQLLSVLDKLHQEGWVFGDLKPENLLITGPPPTVR
FT                   LLDVGGTTLQGRAVKEFTELYDRGYWGVGSRKAEPSYDLFAVAIIMIQSCCPIKLERKG
FT                   DGRRQLISIIQADVMLRKYQTVLMKAIDGKYKRASEMKQDLLAAIGRPDHSHSKQRASQ
FT                   KTVQKSRRSKQRKRGKARGVLETALIIAVLLCAYAVYVYHQVLP"
     atgatgaatc atactttgaa gggtctatgt aaccttccgg cagggacggt cattactgga        60
     aagtggcacc atcagtcgta taaactgcta aaaccgcttg gacatggagc gaatggggcc       120
     gtttatttgg cggaaagcgc gaagggaatt gtcgcgttga aattgagcga caatagcgaa       180
     gcagtgacat cggaagtcaa tgtattacgt cggttttcca aggtccaggg agttgccctt       240
     ggaccttctt tgctagatgt cgatgactgg gcggctcctt tgatgaagaa acatatttct       300
     ttttacgtga tggaatatat aagaggggaa gatttttcca catttattcg caaacacgga       360
     aaagaatggg tggccattct gttgttgcaa cttttatctg tgcttgacaa acttcatcaa       420
     gaaggatggg tgttcggtga tttgaagccg gaaaatttgt taatcacagg cccgccgccg       480
     acggtccgcc ttcttgacgt gggagggaca actttacaag gaagagcggt taaagagttt       540
     accgaacttt atgatcgcgg ctactggggg gtaggatcac ggaaagcaga accttcgtat       600
     gatttgtttg ctgtggcgat catcatgatc cagtcttgct gcccgatcaa gttagaacga       660
     aagggagatg ggcgacggca gctaatttcc atcattcagg cagatgttat gttgcggaaa       720
     tatcagacgg tattaatgaa ggcgattgac gggaagtata aaagagcttc cgaaatgaag       780
     caagacttgt tggccgcgat tggtcgccct gatcattccc attccaagca gcgggcctcc       840
     caaaaaacag ttcagaaatc acggcgaagc aaacaaagaa aacgcggaaa agcgagaggg       900
     gtgttggaaa cggcgctgat cattgccgta cttttatgcg cttacgcggt gtatgtatat       960
     catcaagtgc ttccttga                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page