(data stored in ACNUC7421 zone)

EMBL: CP002293.PE66

CP002293.PE66        Location/Qualifiers
FT   CDS_pept        78721..80625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0066"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="SMART: AAA ATPase; TIGRFAM: ATP-dependent
FT                   metalloprotease FtsH; KEGG: gwc:GWCH70_0064 ATP-dependent
FT                   metalloprotease FtsH; PFAM: peptidase M41; AAA ATPase
FT                   central domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72922"
FT                   /db_xref="GOA:A0A0F6BHM1"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHM1"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ADP72922.1"
FT                   /translation="MNRIFRNTIFYLLIFLVVIGVVSFFNGSNQRTEPMTYDAFITHLE
FT                   NGDVKSFSMKPERGVYEIRGQLKSYSEDQYFSTYVMNSDTVLNRIDAAAQRTRVEVMPA
FT                   DETSGWVTFFTSIIPFVIILILFFFLLNQAQGGGSRVMNFGKSRAKLYTDDKRKVRFRD
FT                   VAGADEEKQELVEIVEFLKDPRKFVELGARIPKGVLLVGPPGTGKTLLARAVAGEAGVP
FT                   FFSISGSDFVEMFVGVGASRVRDLFETAKKNAPCIIFIDEIDAVGRQRGAGLGGGHDER
FT                   EQTLNQLLVEMDGFSGNEGIIIIAATNRPDILDPALLRPGRFDRQITVDRPDVKGREAV
FT                   LRVHARNKPLDESVDLKTIAMRTPGFSGADLENLLNEAALVAARRNKKKIDMSDIDEAT
FT                   DRVIAGPAKKSRVISEKERRIVAYHEAGHTVIGMVLDDAEMVHKVTIVPRGQAGGYAVM
FT                   LPKEDRYFMTKPELMDKITGLLGGRVAEEIVFNEVSTGAHNDFQRATNIARRMVTEFGM
FT                   SEKLGPLQFGQPSGQVFLGRDLHNEQNYSDKIAYEIDLEIQRIIKECYEKAKNILTQYR
FT                   DKLELIATTLLEVETLDAEQIKHLFEHGTLPNRDASNGNNDNGDQDSDVKINIQKKDE"
     atgaatcgga tcttccgaaa tacaatattt tatttattga tttttctcgt cgtcatcggt        60
     gtggttagct tcttcaatgg aagcaatcaa cggacggagc cgatgacata cgatgcgttt       120
     ataactcatt tggaaaatgg tgatgtgaaa tcattttcca tgaagccgga gcgcggcgta       180
     tatgaaataa gagggcagct caaatcgtac agcgaggatc aatacttttc cacttatgtc       240
     atgaacagcg atacggtgtt gaaccgcatt gatgccgcag cgcagcggac gagagtggaa       300
     gtaatgccag cggatgagac gagcggatgg gttacctttt tcacctcgat catcccgttt       360
     gtgattattt taatcttgtt tttcttcttg ttgaaccaag cgcaaggcgg cggcagccgg       420
     gtaatgaact ttgggaaaag ccgggcgaaa ttatacacgg acgacaaacg aaaagttcgt       480
     ttccgtgatg ttgccggtgc tgatgaagaa aaacaagagc ttgtcgaaat tgttgagttt       540
     ttaaaagatc cgcggaagtt tgttgagctt ggtgcccgca ttccaaaagg agtgcttctt       600
     gtcgggcctc ctgggacggg gaaaacgttg ctcgcgcgcg cggttgctgg agaagctggc       660
     gtgccgtttt tctccatcag cggttcggac tttgtggaaa tgttcgttgg tgtcggtgca       720
     tcgcgtgtgc gcgacttgtt tgaaacggcg aaaaagaacg cgccttgtat catatttatt       780
     gacgaaattg acgcggttgg ccggcaacgc ggcgcaggtc ttggcggcgg acatgatgaa       840
     cgcgagcaaa cgctcaacca attgcttgtc gagatggatg gtttcagcgg caatgaagga       900
     attatcatta tcgctgcgac aaaccgccca gatattttag acccagcgtt gttgcgtccg       960
     ggccgttttg accggcaaat tacggtagac cgtccggatg tgaaaggccg tgaagcggta      1020
     ttgcgcgttc atgcccgcaa taagccgctt gatgagtccg ttgatttaaa aacgattgcg      1080
     atgcgtacac cgggcttttc cggggcggat ttggaaaact tgctgaacga ggcggcgctc      1140
     gttgcggctc gacggaataa aaagaaaatt gacatgagcg acattgatga ggcgacagac      1200
     cgcgtcattg ccgggccggc aaagaaaagc cgcgtcattt cggaaaaaga gcggcgcatt      1260
     gtggcgtacc atgaagcagg gcataccgtc attggcatgg tgctcgatga cgcggaaatg      1320
     gtgcacaaag tgacgatcgt tccgcgtggc caagcggggg gctatgcggt gatgcttccg      1380
     aaagaagatc gttattttat gacaaagccg gaactaatgg acaaaattac tggcctatta      1440
     ggcgggcgcg tcgcggaaga aattgtcttt aatgaagtga gcacaggcgc gcataacgat      1500
     tttcaacgtg caacgaacat tgctcgccgc atggttaccg agtttgggat gagcgagaag      1560
     cttggtccgt tgcaattcgg gcagccgagc gggcaagtct ttttaggccg cgacttgcac      1620
     aatgagcaaa attacagcga taaaatcgcg tatgaaatcg atttggaaat tcaacggatt      1680
     attaaagaat gttatgaaaa agcgaaaaac attttaacac aatatagaga caaactggag      1740
     ttaatcgcca ctacgcttct tgaagtggaa acattggatg cggaacaaat taaacattta      1800
     ttcgaacacg gcacattgcc aaaccgcgat gcaagcaatg gcaataacga taatggcgat      1860
     caggacagtg atgtcaaaat aaatattcaa aagaaagatg agtga                      1905
//

If you have problems or comments...

PBIL Back to PBIL home page