(data stored in ACNUC7421 zone)

EMBL: CP002293.PE69

CP002293.PE69        Location/Qualifiers
FT   CDS_pept        82498..83424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0069"
FT                   /product="cysteine synthase"
FT                   /note="KEGG: gwc:GWCH70_0067 cysteine synthase A; TIGRFAM:
FT                   cysteine synthase; cysteine synthase A; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72925"
FT                   /db_xref="GOA:A0A0F6BHM4"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHM4"
FT                   /inference="protein motif:TFAM:TIGR01136"
FT                   /protein_id="ADP72925.1"
FT                   /translation="MARTVNSVTELIGDTPAVKLNRIVDEDSADVYLKLEFMNPGSSVK
FT                   DRIALAMIEAAEKEGKIKPGDTIVEPTSGNTGIGLAMVAAAKGYKAILVMPDTMSLERR
FT                   NLLRAYGAELVLTPGSQGMRGAIAKAEELVKEHGYFMPQQFKNEANPEIHRLTTGKEIV
FT                   EQMGDQLDAFIAGVGTGGTITGAGQVLREKYPNIKIYAVEPADSPVLSGGKPGPHKIQG
FT                   IGAGFVPDILDTSIYDGVITVTTEEAFAAARRAAREEGILGGISSGAAIHAALKIAKQL
FT                   GKGKKVLAIIPSNGERYLSTPLYQFDE"
     atggcaagaa cagtaaactc cgtaacagaa ttgatcggtg atacgccggc ggtgaaatta        60
     aaccgcattg tcgatgaaga cagtgccgat gtttatctta agcttgaatt tatgaacccg       120
     ggaagcagcg tcaaagaccg gattgccttg gcgatgattg aagcggcgga aaaagaggga       180
     aaaataaagc ctggcgacac gattgttgag ccgacaagcg gaaatacagg aattggactg       240
     gccatggtcg cagcggcaaa aggatataaa gcaattttag tcatgccgga tacgatgagt       300
     ttagagcgcc gcaatttatt gcgcgcatac ggcgccgaat tagtgctaac accgggaagc       360
     caagggatgc gcggcgcgat tgccaaagca gaagaattgg tgaaagagca tggttatttt       420
     atgccgcagc aatttaaaaa cgaggcaaac ccggaaatcc accggttaac gacaggaaaa       480
     gaaattgttg agcaaatggg cgaccaattg gacgcattta ttgccggcgt tggtactggc       540
     ggaacgatta ctggtgcggg acaagtcctt cgcgaaaaat atccaaacat taaaatttat       600
     gcggtagagc ctgctgattc accggtatta tcgggcggaa aaccaggtcc tcataaaatt       660
     caaggaatcg gtgccggatt tgtgccggat attttagata caagcattta tgatggagtc       720
     attaccgtta cgacagaaga agcgttcgcc gccgcccgcc gcgctgcccg cgaagaaggc       780
     attcttggcg gaatttcctc tggcgccgct attcatgctg cattaaaaat cgctaaacag       840
     cttggcaaag ggaaaaaagt gttggcgatc atcccaagta acggtgaacg ctacttaagc       900
     actccgcttt accaattcga tgaataa                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page