(data stored in ACNUC7421 zone)

EMBL: CP002293.PE7

CP002293.PE7         Location/Qualifiers
FT   CDS_pept        9167..10252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0007"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: gwc:GWCH70_0007 metal dependent
FT                   phosphohydrolase; PFAM: metal-dependent phosphohydrolase HD
FT                   sub domain; SMART: metal-dependent phosphohydrolase HD
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72863"
FT                   /db_xref="GOA:A0A0F6BHG2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHG2"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADP72863.1"
FT                   /translation="MIRVKLHQLQEGCILAEDVLGKTQKTIMPKNTILTPYLLNVLEKF
FT                   LIQEVYVEPVLANGKPFKPAELLDRREEDSPSDEQPIYLYLQAVQKYKKAFQSWQSGAP
FT                   IDIGQIRNIIIPLFDKLIHNRKKLLALHRYVTKEDYLYHHAVSVGLLSGFLAKQLNYSK
FT                   SDCYQIVLAGILSDCGMARVDKRILTKNSALTTHEYEEMKQHTVIGYRMVEKIKTLKEG
FT                   VKLAVLQHHERIDGTGYPFGIRGQQIHPYSKIVAVADVYHAMTSERLYRSRQSPFKALE
FT                   KIQIEQFGKLSMEAIQILLDNLINFHVGTVVKLSNGEMAEIVFIQREAPTRPIVKIVDK
FT                   DEFLSLSEHRDIYIEEVVYND"
     atgatccggg tgaaacttca ccagttgcaa gaaggatgta ttctcgctga agatgtgctt        60
     ggcaagaccc aaaagacaat catgcctaaa aatacgatac tgacaccata tttattaaac       120
     gtgttggaaa aatttttaat tcaagaagtg tacgttgaac cagttctggc aaatggaaaa       180
     ccatttaagc cggctgaatt gctggatcgg cgtgaagagg atagccctag cgatgaacag       240
     ccgatatacc tttatttaca agcagttcaa aaatataaaa aagcatttca atcgtggcaa       300
     tccggtgctc ctattgatat aggacaaata agaaacatta ttattccttt attcgataaa       360
     ttgatacata accgcaaaaa attactagcg ttacatcgtt atgtgacaaa ggaagactat       420
     ttataccatc acgctgttag cgtcggatta ttatcgggat ttttggcaaa acaattaaat       480
     tatagtaaaa gtgattgtta tcaaattgtg ctggcgggga tattgtccga ctgcggcatg       540
     gcgagggtgg acaaaaggat tttgacaaaa aactcggcac ttactactca tgaatatgaa       600
     gaaatgaaac agcatacagt gatcggttat cgaatggtcg aaaaaataaa gactttaaaa       660
     gaaggagtaa aattggctgt attacagcat catgaacgaa ttgatggaac tggctatccg       720
     tttggaattc gtggccagca aattcaccca tacagcaaaa tagtagctgt agctgacgtt       780
     tatcacgcga tgacatccga acgtctttat cggtccagac aatccccttt taaagcgctc       840
     gaaaaaattc aaattgaaca gtttggaaaa ttaagtatgg aagcgataca aatattgcta       900
     gacaatttaa ttaattttca tgtagggaca gttgtcaaat tgtcaaacgg cgaaatggca       960
     gaaatcgttt ttatacaacg ggaagcgccg acaagaccga ttgtcaaaat cgttgataaa      1020
     gatgaatttc tttctttaag cgaacatcgg gatatttata ttgaggaagt tgtttataac      1080
     gactag                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page