(data stored in SCRATCH zone)

EMBL: CP002293.PE70

CP002293.PE70        Location/Qualifiers
FT   CDS_pept        83542..84957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0070"
FT                   /product="para-aminobenzoate synthase, subunit I"
FT                   /EC_number="4.1.3.27"
FT                   /note="TIGRFAM: para-aminobenzoate synthase, subunit I;
FT                   KEGG: gtn:GTNG_0066 P-aminobenzoate synthase; PFAM:
FT                   Chorismate binding-like; Anthranilate synthase component I
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72926"
FT                   /db_xref="GOA:A0A0F6BHM5"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHM5"
FT                   /inference="protein motif:TFAM:TIGR00553"
FT                   /protein_id="ADP72926.1"
FT                   /translation="MRKWGNRKRRTLPYSNRDWFRQYKALAAHEPYHVLLESGQGGRYS
FT                   IIGLTPAGVIQAKENQLFISYHGETKWYEGNPLLSLKQWFAQFPLHFSKSELPFQGGAI
FT                   GYISYDCARYIEKIPSYAQDDLQLPSMYFLIFDDVFVYDHQKQLLHMIVHYADGEELEA
FT                   ERRLSFYESRWLEAEQCEGEWMFQKQDANPSVSMTKADFVEAVQKVQQYIAQGDVFQVN
FT                   LSVRQSKPLLTHPFHIYEQLRVINPSPYMAYIHFPEFQIVSGSPELLVKKRGDDISTRP
FT                   IAGTRSRGKTEEEDKWLATKLLSSEKEIAEHAMLVDLERNDLGRVCQYGTVKVDEWMTI
FT                   ERYSHVMHIVSHVSGKLKQGKDAFDVIQAMFPGGTITGAPKVRTMEIIEELEPVRRGIY
FT                   TGSIGWISFDGDMEFNIAIRTMIAKDGIAHVQAGAGIVIDSHPEHEYRECLKKAAALWK
FT                   AKELSEAEKSLRV"
     gtgcggaaat ggggaaatag aaagaggcga acgcttcctt actcgaaccg tgattggttt        60
     cggcaatata aggcacttgc tgctcatgag ccgtaccatg ttttgctaga aagcggtcaa       120
     ggcggacgct acagcattat cggtttaact cctgcgggtg tcattcaagc gaaagaaaat       180
     cagctcttta tttcttatca cggtgaaacg aagtggtatg aagggaatcc gctattatcg       240
     ctcaagcaat ggttcgcgca atttccgctt cacttttcca aaagtgaatt gccttttcaa       300
     ggcggggcga ttggctatat cagctatgat tgtgcaagat atattgaaaa aatcccttca       360
     tatgcacaag acgatttgca gcttccatcg atgtactttc tgatttttga tgacgtattc       420
     gtgtacgatc accaaaagca gttgctccat atgattgttc attacgcgga cggcgaagaa       480
     ctggaagcgg aacggcgcct ttctttttat gagtcacgtt ggttagaagc ggagcaatgc       540
     gaaggcgaat ggatgtttca aaaacaagac gccaatccat cggtgtcgat gacaaaagcg       600
     gattttgtcg aagcggtcca aaaagttcag caatatattg cccaaggcga cgtgtttcaa       660
     gtgaatttat ccgtgcggca atcgaagccg ctgttgacac atccatttca tatttatgag       720
     cagctgcgcg tcattaatcc gtctccatac atggcgtaca tccactttcc ggaatttcaa       780
     attgtcagcg gatcgcctga attgcttgtc aaaaaacggg gggatgacat tagcacaagg       840
     ccgattgccg gaacgcgctc acgcggaaag acggaggaag aagacaaatg gctggcaacc       900
     aagctgcttt ctagcgaaaa agaaatagcg gaacatgcga tgctcgtcga tttagagcgc       960
     aatgatctgg ggcgtgtatg ccaatatggc acggtaaaag tagatgaatg gatgaccatc      1020
     gaacgttatt cccacgttat gcatatcgtg tcccatgtgt caggaaaatt aaagcaagga      1080
     aaagatgcgt ttgatgtcat acaggcgatg tttcctggcg gcacgattac cggagctcca      1140
     aaagtgcgga caatggagat tatcgaagag cttgagccgg tgcggcgcgg catatatacc      1200
     ggttccatcg gatggattag ttttgatgga gatatggaat ttaacattgc gattcgcacg      1260
     atgattgcca aagatggaat cgcacatgtg caagcgggag ccgggattgt cattgattcc      1320
     catcctgaac atgaatatcg cgaatgtttg aaaaaggcgg cggccctttg gaaagcaaaa      1380
     gagctgagcg aagcggagaa atcattaaga gtatga                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page