(data stored in SCRATCH zone)

EMBL: CP002293.PE73

CP002293.PE73        Location/Qualifiers
FT   CDS_pept        86425..87279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0073"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="TIGRFAM: dihydropteroate synthase; KEGG:
FT                   gwc:GWCH70_0072 dihydropteroate synthase; PFAM:
FT                   dihydropteroate synthase DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72929"
FT                   /db_xref="GOA:A0A0F6BHM8"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHM8"
FT                   /inference="protein motif:TFAM:TIGR01496"
FT                   /protein_id="ADP72929.1"
FT                   /translation="MATTSATPFVLRCGDYELDLRKKTMVMGIVNVTPDSFSDGGRFYD
FT                   LDRAVEHAKQLVADGADIIDIGGESTRPGAEKVSLEEELRRVIPVVKAVAQEINVPISI
FT                   DTYKAEVAKQAIEAGAHIINDVWGAKADEKMAEVAAFYDVPIILMHNRHDLQYRDLISD
FT                   MISDLMESVAIVKRAGVKDENIILDPGIGFAKTLEHNLEIMRRLDEFAKLGYPLLLGTS
FT                   RKRFIGHVLDLPVDERVEGTGATVCLGIAKGAHIVRVHDVLPIARMVKMMDAMLGKGVA
FT                   NDR"
     atggctacaa caagtgcaac cccttttgtg ctgcgctgcg gggattacga gctggatttg        60
     cgaaaaaaaa caatggtcat ggggattgtc aacgtaacgc cggattcttt ctctgacggc       120
     ggacggtttt atgatctcga ccgcgcggtg gagcacgcaa agcaacttgt tgccgatggt       180
     gcggacatta ttgatattgg cggggaatcg acccggccag gtgctgagaa agtatcgctt       240
     gaggaagagc tgcggcgggt aattcctgtg gtgaaagcgg tcgctcaaga aatcaatgtc       300
     cctatttcca ttgatacgta taaagcggaa gtcgccaaac aagcgatcga agcgggagcg       360
     cacatcatta acgatgtatg gggggcaaaa gcagacgaga aaatggcgga agtcgccgct       420
     ttttatgatg ttccgattat tttaatgcat aatcgccatg atcttcagta ccgtgattta       480
     atttccgata tgatttctga tttaatggaa agtgtcgcca tcgtaaaacg cgcaggcgtg       540
     aaagacgaaa acattatttt agatccgggg atcggatttg cgaaaacatt ggagcataat       600
     ctggaaatta tgcgccgttt agatgaattt gccaaactag gatatccgct cttgcttggc       660
     acgtcacgga aacggtttat cggccatgtc cttgatttac cggttgatga acgagtcgaa       720
     gggacaggag cgaccgtatg cttgggaatc gcaaagggag ctcatatcgt ccgcgttcac       780
     gatgtattgc caattgcgcg aatggtgaaa atgatggatg caatgcttgg aaaaggagtg       840
     gcgaacgatc gataa                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page