(data stored in ACNUC7421 zone)

EMBL: CP002293.PE76

CP002293.PE76        Location/Qualifiers
FT   CDS_pept        88111..88329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0076"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: gwc:GWCH70_0075 transcriptional regulator, XRE
FT                   family; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72932"
FT                   /db_xref="GOA:A0A0F6BHN1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHN1"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADP72932.1"
FT                   /translation="MEAEKWGRRIRAFRKLKGYTQERLAKELGISVSILGEIERGNRLP
FT                   TEELVQQIAERLNISVEELAPHSEAGK"
     atggaagcag aaaaatgggg aagacgtatt cgcgcttttc gaaagctaaa aggatatacg        60
     caagaaaggc tggcaaaaga acttggcata tctgtgtcga ttttaggaga aattgaacga       120
     ggaaatcgtt taccgacaga ggaattagtg cagcaaattg ccgagcggtt gaatatatct       180
     gtcgaagagc ttgcgccgca ttcagaagcc gggaaataa                              219
//

If you have problems or comments...

PBIL Back to PBIL home page