(data stored in ACNUC7421 zone)

EMBL: CP002293.PE78

CP002293.PE78        Location/Qualifiers
FT   CDS_pept        89437..90921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0078"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="KEGG: gwc:GWCH70_0078 lysyl-tRNA synthetase;
FT                   TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA synthetase class
FT                   II (D K and N); nucleic acid binding OB-fold
FT                   tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72934"
FT                   /db_xref="GOA:A0A0F6BHN3"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHN3"
FT                   /inference="protein motif:TFAM:TIGR00499"
FT                   /protein_id="ADP72934.1"
FT                   /translation="MSHEELNDQLRVRREKLHKLREMGIDPFGKRFERTHKAQELFDLY
FT                   GDLSKEELEEKQIKVAVAGRIMTKRGKGKAGFAHIQDVTGQIQIYVREDAVGPEQYELF
FT                   KTSDLGDIIGVCGTVFKTKVGELSIKVSSYEFLTKALRPLPEKYHGLKDIEQRYRQRYL
FT                   DLIMNPDSKNTFITRSRIIQSMRRYLDSHGYLEVETPMMHNIAGGAAARPFITHHNALD
FT                   MPLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMLELYEAYADFRDI
FT                   MTLTENLIAHIAQEVLGTTKIQYGEHKVDLTPEWKRLHMVDAIKEYVGVDFWKQMSDEE
FT                   ARELAKEHGVEIAPHMTFGHIVNEFFEQKVEDKLIQPTFIYGHPVEISPLAKKNPDDPR
FT                   FTDRFELFIVGREHANAFTELNDPIDQRERFEAQLKEREQGNDEAHEMDEDFIEALEYG
FT                   MPPTGGLGIGVDRLVMLLTNSPSIRDVLLFPQMRNK"
     atgagtcatg aagaacttaa cgatcaattg cgagtccgca gggaaaaatt acataaatta        60
     agagaaatgg gaattgatcc gtttggcaaa cggtttgaac gaacacataa agcacaagaa       120
     ctgtttgatt tatacggtga tttatcaaaa gaagaactgg aagaaaaaca aataaaagtt       180
     gctgttgccg ggcgcattat gacaaaacgg ggcaaaggta aagcgggatt cgcccatatt       240
     caagacgtca ctggccaaat tcaaatttac gttcgtgaag atgcggtcgg cccagagcaa       300
     tacgagcttt tcaaaacttc tgatttaggc gatattatcg gtgtttgcgg aacggtattt       360
     aaaacaaaag tcggagagct gtccattaaa gtatcctctt atgaattttt aacaaaagcg       420
     ctgcgcccgc ttccggaaaa ataccatggg ctaaaagaca tcgaacagcg ttaccgacaa       480
     cggtatttag atttaattat gaatccggac agcaaaaata cgtttatcac acgcagccgg       540
     attattcaat cgatgcgccg ttacttagat agccatggct atttagaagt cgaaacgccg       600
     atgatgcaca acattgccgg aggagcggcg gctcgtccgt ttatcactca ccataacgcg       660
     ttggatatgc cgttatatat gcggatcgcg atcgagcttc atttgaaacg tttaattgtc       720
     ggcggattag aaaaagttta tgagataggc cgtgtgttcc gtaatgaagg agtttctaca       780
     cgccataacc cagaatttac gatgcttgag ctgtacgaag cgtacgcgga tttccgcgat       840
     attatgacat tgacggaaaa cttaattgcc cacatcgccc aagaagtgtt agggacgaca       900
     aaaatccagt atggagagca taaggttgat ttaactcctg aatggaaacg acttcatatg       960
     gtagatgcga ttaaagaata tgtgggcgtc gatttttgga aacaaatgag cgatgaagaa      1020
     gctagggaat tggcaaaaga gcatggtgtg gaaatagccc cgcatatgac gtttggccat      1080
     attgtgaatg agttttttga gcagaaagta gaggacaagc ttattcagcc aacatttatt      1140
     tatggacatc cggtggaaat ctcgccgtta gcgaagaaaa atccagacga tccgcgcttt      1200
     acagaccgct ttgaattgtt tatcgtcggt cgtgagcatg caaatgcatt taccgaatta      1260
     aatgatccga ttgaccagcg tgagcgcttt gaagcacagc tgaaagagcg ggagcaggga      1320
     aatgacgaag cccacgagat ggacgaagac ttcatcgaag cgcttgaata tggaatgcca      1380
     ccaacgggtg gtttgggcat tggtgttgac cgacttgtta tgctattgac aaattcaccg      1440
     tctattcgtg atgtgttgct atttccacaa atgcgtaaca aataa                      1485
//

If you have problems or comments...

PBIL Back to PBIL home page