(data stored in ACNUC7421 zone)

EMBL: CP002293.PE82

CP002293.PE82        Location/Qualifiers
FT   CDS_pept        104704..107142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0082"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="KEGG: gwc:GWCH70_0083 ATPase AAA-2 domain protein;
FT                   PFAM: ATPase AAA-2 domain protein; AAA ATPase central
FT                   domain protein; UvrB/UvrC protein; Clp domain protein; Clp
FT                   ATPase-like; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72938"
FT                   /db_xref="GOA:A0A0F6BHN7"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHN7"
FT                   /inference="protein motif:PFAM:PF07724"
FT                   /protein_id="ADP72938.1"
FT                   /translation="MMMFGRFTERAQKVLALAQEEAIRLGHNNIGTEHILLGLIREGEG
FT                   IAAKALMALGLGPEKIQKEVESLIGRGHEVSHTIHYTPRAKKVLELSMDEARKLGHSYV
FT                   GTEHILLGLIREGEGVAARVLNNLGVSLNKARQQVLQLLGSNESVSGHSGGGASHVSTP
FT                   TLDSLARDLTAIAREGRLDPVVGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEG
FT                   LAQQIINNEVPETLRDKRVMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNIILFID
FT                   ELHTLIGAGGAEGAIDASNILKPALARGELQCIGATTLDEYRKYIEKDAALERRFQPIY
FT                   VDEPTVEESIQILKGLRDRYEAHHRVSISDDAIVQAVKLSDRYITDRFLPDKAIDLIDE
FT                   ACSKVRLRSFTAPPKLKELEQKLEEVRKEKDAAVQSQEFEKAASLRDMEQRLREELEET
FT                   KRAWKEKQGQENSEVTVEDIAMVVSSWTGIPVAKLAQTETERLLKLEEILHSRVVGQDE
FT                   AVKAVAKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAEAMFGDEDALIRIDM
FT                   SEYMEKHSTSRLIGSPPGYVGYEEGGQLTEKVRRKPYSVVLLDEMEKAHPDVFNILLQV
FT                   LEDGRLTDSKGRTVDFRNTIIIMTSNVGADALKRNKYVGFNVQDEDQKYKDMKGKVMDE
FT                   LKRAFRPEFLNRIDEIIVFHSLEKQHLKQIVKLMADTLIKRLKEQDIDLELTDAAIEKI
FT                   VSEGYDPEYGARPLRRALQKQVEDRLSEELLKGTIAKGQKVIVDVKDGEFVVLAKQAVM
FT                   "
     atgatgatgt ttggaagatt tacggaacgg gcgcaaaaag tgttggcgct ggctcaagaa        60
     gaggcaatac gccttggcca taataacatt ggcacagaac acattttatt aggtcttatt       120
     cgtgaagggg aaggaattgc ggcgaaagca ttaatggcat tggggcttgg gccagaaaaa       180
     attcaaaaag aggtagaatc gttaatcggc cgcggccatg aagtttccca tacgatccat       240
     tatacgccgc gggcgaaaaa agtgcttgaa ttgtcaatgg atgaggcgag aaagcttggc       300
     cattcctatg taggcacgga acatattttg cttggcctca ttcgtgaagg cgaaggagtt       360
     gcggcccgcg tactgaacaa tttaggagtg agcctgaata aagcgcgcca acaagtgctg       420
     caattgcttg gaagcaatga atccgtttcc ggtcattccg gaggaggtgc ttcgcacgta       480
     agcacaccaa cattagacag cttggcccgt gatttaacgg caattgcccg tgaaggtaga       540
     ttggacccgg ttgttggtag aagcaaagaa attcagcgtg tcatcgaagt attaagccgc       600
     cgtacaaaaa ataacccggt gctaatcgga gagcctggag ttgggaaaac ggcgattgct       660
     gaagggcttg cgcagcaaat catcaataac gaagtgccgg aaacgctccg cgataagcgg       720
     gtcatgacgc tggacatggg aacggttgta gccggtacga aataccgcgg ggaatttgaa       780
     gatcgtttga aaaaagtgat ggatgaaatt cgccaggcag gaaacatcat tctcttcatt       840
     gatgagctcc atacgcttat tggcgcaggt ggagcggaag gtgcgattga tgcatcgaac       900
     atcttgaagc cagcgcttgc gcgtggggaa ctgcaatgca tcggtgcgac tacattggac       960
     gaatatcgga aatatattga aaaagatgcg gcgcttgaac gccgtttcca accgatttat      1020
     gtcgatgagc cgacagtaga agaatcgatt caaattttga aaggattgcg tgatcgctat      1080
     gaagcccatc atcgcgtatc tatttccgat gatgcgatcg ttcaggcggt aaaattatct      1140
     gaccgttata ttaccgaccg ttttcttcca gataaagcga tcgatttaat cgatgaagca      1200
     tgctcgaaag ttcgcctgcg ttcgtttacg gcgccgccaa aattaaaaga gctcgaacaa      1260
     aaactggaag aagtgcgtaa ggaaaaagac gccgctgtac aaagccaaga atttgaaaaa      1320
     gctgcttcgc tgcgcgacat ggagcaacgc ttacgcgaag aactcgaaga aacgaaacgc      1380
     gcgtggaaag aaaaacaagg ccaagaaaac tcagaggtaa cggttgagga catcgcgatg      1440
     gtcgtttcaa gctggactgg aattccagta gcgaaattag cgcagacgga aacagaacga      1500
     ttattgaaac tagaagaaat tttacattcc cgcgtcgttg gtcaagacga agcagtaaaa      1560
     gcagttgcca aagcggtccg tcgcgcgcgc gctggattaa aagacccgaa acgtcctatt      1620
     ggatcgttca ttttccttgg tccaactggt gtcggcaaaa ccgaattggc aagagcgctt      1680
     gccgaagcga tgttcggcga tgaagacgca cttattcgca tcgatatgtc tgaatatatg      1740
     gagaagcact cgacatctcg tttgattggt tcgcctcctg gatatgttgg gtacgaggaa      1800
     ggcggccagc taacagaaaa agtgcgccgc aagccgtatt cggttgtgtt gttagatgag      1860
     atggaaaaag cccatccaga cgtatttaac attttgttgc aagtgttgga agacggtcgt      1920
     ttgactgact cgaaaggaag aacggttgac ttccgcaata cgattatcat tatgacgtcc      1980
     aacgttggcg cagatgcgtt aaagcggaac aaatacgtcg gttttaacgt ccaagatgaa      2040
     gatcaaaagt acaaagatat gaaaggaaag gtcatggacg agttaaagag agcattccgc      2100
     ccagagtttt taaaccgcat tgatgaaatt atcgtcttcc attcgcttga aaaacaacat      2160
     ttaaaacaaa ttgtcaaatt gatggcagac acgttgatca aacgtttaaa agaacaagat      2220
     atcgatttag aactgacgga tgcggcgatt gaaaaaattg tctcggaagg atatgatccg      2280
     gaatatggtg ctcgcccatt gcgccgcgcg ttgcaaaaac aggtggaaga tcgtttgtcg      2340
     gaagagctgt tgaaaggaac gattgccaaa gggcaaaaag tgatcgtaga cgtaaaagac      2400
     ggggaattcg tcgttttagc gaaacaagct gtgatgtaa                             2439
//

If you have problems or comments...

PBIL Back to PBIL home page