(data stored in ACNUC7421 zone)

EMBL: CP002293.PE85

CP002293.PE85        Location/Qualifiers
FT   CDS_pept        109834..110520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0085"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="KEGG: gwc:GWCH70_0086 2-C-methyl-D-erythritol
FT                   4-phosphate cytidylyltransferase; TIGRFAM:
FT                   2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase;
FT                   PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72941"
FT                   /db_xref="GOA:A0A0F6BHP0"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHP0"
FT                   /inference="protein motif:TFAM:TIGR00453"
FT                   /protein_id="ADP72941.1"
FT                   /translation="MMYEVVIPAAGQGKRMKAGMNKQLIELRNEPLIVRTLKVFENDEW
FT                   CRGIIVVINEAERTQFEQLFSRFHIKKITAVVGGGKERQHSVYNGLRAVKNSDIVLIHD
FT                   GARPFVTIEQIHELVNEAKEHGAAIPAVRVKDTIKKVCDQFVEETVERSGLWAVQTPQA
FT                   FHVSLVLRAHEQAQKDGYIGTDDASLVERIGGKVKIIEGDYRNIKLTTPDDLLFAEVIL
FT                   SSWVSS"
     atgatgtatg aggtagttat tcctgcagca gggcaaggga agcgaatgaa ggcgggaatg        60
     aataagcaat tgattgagct gcgaaatgaa ccgctgattg tgcgcacatt aaaagtgttt       120
     gaaaacgatg aatggtgccg cggcattatc gttgttatta atgaagcgga aagaacgcaa       180
     tttgaacaac tattttcccg tttccatatc aaaaaaatca ctgcggtcgt aggcggtgga       240
     aaagagcggc agcatagcgt ctacaatgga ttgagagcgg taaaaaatag cgatattgtg       300
     ctgattcatg atggcgcgcg cccgttcgtt acgatagagc agattcatga gttagtcaat       360
     gaagcgaagg aacacggcgc ggccattccg gctgtacgcg ttaaagacac catcaaaaaa       420
     gtttgcgacc agtttgtcga ggaaacggtg gaacgctctg gcttgtgggc tgtacaaact       480
     ccacaagctt ttcatgtttc gctcgtattg cgggctcatg agcaagcgca aaaagacggc       540
     tatattggca cagatgatgc gagcctagtg gagcggattg gcggaaaagt caaaattatc       600
     gagggggatt accgcaatat taaattgacg acgccggatg atttattgtt tgcagaagta       660
     attttatcca gctgggtcag ttcataa                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page