(data stored in ACNUC7421 zone)

EMBL: CP002293.PE86

CP002293.PE86        Location/Qualifiers
FT   CDS_pept        110538..111014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0086"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /note="KEGG: gwc:GWCH70_0087 2C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase; TIGRFAM:
FT                   2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase; PFAM:
FT                   MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72942"
FT                   /db_xref="GOA:A0A0F6BHP1"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHP1"
FT                   /inference="protein motif:TFAM:TIGR00151"
FT                   /protein_id="ADP72942.1"
FT                   /translation="MFRIGQGFDVHQLVEGRPLIIGGVRIPYEKGLLGHSDADVLLHAV
FT                   ADACLGAIGAGDIGKHFPDTDERYKDADSALLLKQVWELVKRQGYKLVNLDCTVIAQKP
FT                   KMAPHIEQMKENIAKLLEGESSQVNIKATTTEKLGFTGRGEGIAAQAVVLLQKQ"
     atgtttcgca ttggtcaagg gtttgatgtt catcagcttg ttgagggccg cccccttatt        60
     attggaggcg tccgcattcc atacgaaaag gggctgcttg gccattctga cgctgatgtg       120
     ttgttgcatg cggtcgcgga tgcctgttta ggagcaattg gcgcgggtga catcggaaag       180
     cattttccag atacagatga acgctataaa gatgccgact ctgcgctgtt attaaaacaa       240
     gtatgggaat tagtcaagcg ccaagggtac aaacttgtga atcttgattg cacggtgatc       300
     gcgcaaaagc cgaagatggc gccgcatatt gagcaaatga aagaaaacat tgcgaaattg       360
     ctggaaggag aatcatcgca agtcaatatt aaagcgacaa cgacggaaaa gctgggcttt       420
     actggccggg gagaaggaat cgccgcacaa gcggttgtat tattgcaaaa acagtaa          477
//

If you have problems or comments...

PBIL Back to PBIL home page