(data stored in SCRATCH zone)

EMBL: CP002293.PE89

CP002293.PE89        Location/Qualifiers
FT   CDS_pept        113577..114977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0089"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="SMART: Cysteinyl-tRNA synthetase class Ia DALR;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; KEGG: gwc:GWCH70_0090
FT                   cysteinyl-tRNA synthetase; PFAM: Cysteinyl-tRNA synthetase
FT                   class Ia ; Cysteinyl-tRNA synthetase class Ia DALR"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72945"
FT                   /db_xref="GOA:A0A0F6BHP4"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHP4"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ADP72945.1"
FT                   /translation="MSSIRLYNTLTRKKEPFEPLEPNKVKMYVCGPTVYNYIHIGNARA
FT                   AIVFDTIRRYLEFRGYEVKYVSNFTDVDDKLIKAARELGEDVPTVAERFIQAYFEDITA
FT                   LGCKKADVHPRVTENMDTIIEFIQALVEKGYAYEVDGDVYYRTRKFAEYGKLSHQSIDE
FT                   LKAGARIEIGEKKEDPLDFALWKAAKEGEICWDSPWGKGRPGWHIECSAMARKYLGDTI
FT                   DIHAGGQDLTFPHHENEIAQSEALTGKPFAKYWLHNGYLNINNEKMSKSLGNFVLVHDI
FT                   IRQIDPQVLRFFMLSVHYRHPINYSEELLENAKKGLERLKTAYFNLKHRLQSSTNLTDD
FT                   DEQWLARIQEQHEAFIREMDDDFNTANGIAVLFELAKQANLYLHEKNTSERVIHAFLRE
FT                   LEQLLDVLGITLQEEELLDEEIEALIQKRNEARKNRNFALADQIRDELRAKNIILEDTP
FT                   QGTRWKRG"
     atgagcagca ttcggcttta taacacattg acaagaaaaa aggaaccgtt tgagccgctt        60
     gaaccgaata aagtaaaaat gtacgtatgc ggtccgacgg tgtataacta tatccatatc       120
     ggcaacgccc gcgctgcgat cgtattcgat acgattcgcc gctacctaga gtttcgcggt       180
     tatgaagtga agtatgtatc caattttacc gatgtcgatg ataagctcat aaaagcggcg       240
     cgcgaattgg gagaagatgt gccgacggtc gcggagcgtt ttattcaagc atattttgaa       300
     gacattacag cgcttggatg caaaaaagcg gatgtgcatc cacgcgtcac cgaaaatatg       360
     gatacgatta ttgaatttat tcaagcattg gttgaaaaag gttatgcgta cgaagtcgat       420
     ggcgatgtgt actatcgtac aagaaaattt gcagagtacg gcaaactttc gcatcagtct       480
     attgatgaac tgaaagcggg agcgcgcatt gaaattggcg aaaagaaaga agatccgctt       540
     gatttcgcat tatggaaagc ggcaaaagag ggggaaattt gctgggatag cccgtgggga       600
     aaagggcgcc cgggctggca tattgaatgc tcggcaatgg cgcgcaaata tttgggagat       660
     acgattgata tccacgctgg tggtcaagat ttgacgttcc cgcatcatga gaatgaaata       720
     gcccagtccg aagcgttgac aggcaaaccg tttgcaaaat attggcttca taacggctat       780
     ttgaatatta ataacgaaaa aatgtcgaaa tcgctcggca acttcgtgct tgttcacgac       840
     attatccggc aaatcgatcc gcaagtattg aggtttttta tgctttcggt tcactaccgt       900
     catccgatta actatagcga agaattgtta gaaaatgcga aaaagggatt ggaacggtta       960
     aaaacggctt attttaattt aaaacatcga ttgcaaagca gcacgaactt aaccgatgac      1020
     gacgagcagt ggctcgcgcg cattcaagag cagcatgagg cgtttatccg ggaaatggac      1080
     gacgatttta atacggccaa tggaatcgct gtgttgtttg aactggcgaa acaagcgaat      1140
     ttgtatttgc atgaaaagaa tacatcggaa cgcgttattc atgcattttt gcgcgaattg      1200
     gaacagctgc ttgacgtgct tggcattacg ttgcaagaag aggaattgct ggacgaggaa      1260
     atcgaagcgc tcattcaaaa gcggaacgaa gcgagaaaaa accggaattt tgctttagcg      1320
     gatcaaattc gtgatgaatt aagagcgaaa aacattattt tggaagatac gccgcaagga      1380
     acaagatgga aaagaggata a                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page