(data stored in ACNUC7421 zone)

EMBL: CP002293.PE9

CP002293.PE9         Location/Qualifiers
FT   CDS_pept        17076..18542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0009"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="SMART: CBS domain containing protein; TIGRFAM:
FT                   inosine-5'-monophosphate dehydrogenase; KEGG:
FT                   gwc:GWCH70_0009 inosine-5'-monophosphate dehydrogenase;
FT                   PFAM: IMP dehydrogenase/GMP reductase; CBS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72865"
FT                   /db_xref="GOA:A0A0F6BHG4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHG4"
FT                   /inference="protein motif:TFAM:TIGR01302"
FT                   /protein_id="ADP72865.1"
FT                   /translation="MWESKFAKEGLTFDDVLLIPAKSDVLPRDVDVTTKLSETLQLNIP
FT                   IISAGMDTVTEAEMAIAMARQGGLGIIHKNMSIEQQAEQVDKVKRSERGVITDPFFLTP
FT                   EHQVYDAEHLMSKYRISGVPIVNNEEEQKLVGIITNRDLRFIQDYSTKISDVMTKENLI
FT                   TAPVGTTLEEAEKILQKYKVEKLPLVDENGILKGLITIKDIEKVIEFPNSAKDAKGRLL
FT                   VGAAVGVTADTMIRVKKLVEANVDVIVVDTAHGHSKGVLETVRKIREQYPDLNIIAGNV
FT                   ATAEATRDLIEAGANIIKVGIGPGSICTTRVVAGVGVPQITAIYDCATEARKHGVPIIA
FT                   DGGIKYSGDIVKALAAGAHAVMLGSLLAGVSESPGETEIYQGRRFKVYRGMGSVAAMEK
FT                   GSKDRYFQEDNKKFVPEGIEGRVPYKGPLADTIYQLVGGLRAGMGYCGTRNLEELREKT
FT                   QFIRMTSAGLRESHPHDVQITKEAPNYSIS"
     atgtgggaat cgaaatttgc taaagaggga ttaacgtttg acgatgtgct gcttattcct        60
     gctaaatctg atgtattgcc tcgcgatgtc gatgtgacga caaaattgag cgaaacatta       120
     cagttgaata tcccgattat tagcgcagga atggatacgg taacggaagc agaaatggcc       180
     atcgcaatgg caagacaagg tggacttgga attatccata aaaatatgtc catcgagcag       240
     caagcagaac aagtagataa agtgaaacgt tcggagcgag gagtcattac agatccgttt       300
     ttcttaaccc ctgaacatca agtgtacgat gcggaacatt taatgagtaa atatcgtatt       360
     tctggcgtgc cgatcgtcaa taatgaggaa gaacaaaagc ttgttggcat tattacaaac       420
     cgtgatttac gattcattca agattattcg acaaaaattt ccgatgtgat gacaaaagaa       480
     aatttaatca cggctccggt aggaacgacg ttagaagaag cggaaaagat tttacaaaag       540
     tacaaagtcg aaaagttgcc gcttgttgat gaaaatggaa tattaaaggg attaatcacg       600
     atcaaagata tcgaaaaagt aatcgagttt ccgaattctg caaaagacgc gaaaggtcgt       660
     cttcttgtcg gggcggctgt tggcgtgaca gccgatacga tgattcgcgt aaaaaaactg       720
     gtagaagcaa acgttgatgt cattgtcgta gacacggcgc acggtcattc taaaggtgtt       780
     cttgagacgg ttcgcaaaat tcgcgaacaa tatccggact taaatattat cgcgggaaat       840
     gtcgcgacag cagaggcgac acgcgacttg attgaggcag gagcgaacat catcaaagtc       900
     ggcattggac ctgggtcgat ctgtacgacg cgcgttgtcg cgggggtcgg tgtgccgcaa       960
     ataacggcaa tatatgattg tgcgacagaa gcgcgcaaac atggtgttcc gatcatcgct      1020
     gacggcggaa ttaaatattc cggcgacatt gtgaaagcat tggcggcagg cgcgcatgcg      1080
     gtcatgctgg gaagcctttt agccggagta tcagaaagcc ctggagaaac agaaatttat      1140
     caaggaagaa gatttaaagt atatcgcggc atgggttctg ttgctgcaat ggaaaaagga      1200
     agcaaagacc gttatttcca agaagataat aaaaaattcg ttcctgaagg aattgaagga      1260
     cgcgttcctt acaaaggacc tttggctgac acgatttacc agcttgtcgg tggtttgcga      1320
     gcgggcatgg gatattgcgg cacaagaaat ttagaagaac tgcgagaaaa gacccaattt      1380
     attcgcatga cgagcgcagg attgcgcgaa agccatccgc acgatgtaca aattacgaaa      1440
     gaggcgccaa actattctat ttcttaa                                          1467
//

If you have problems or comments...

PBIL Back to PBIL home page