(data stored in SCRATCH zone)

EMBL: CP002293.PE90

CP002293.PE90        Location/Qualifiers
FT   CDS_pept        114983..115402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0090"
FT                   /product="ribonuclease III"
FT                   /note="KEGG: gwc:GWCH70_0091 ribonuclease III; PFAM:
FT                   ribonuclease III; SMART: ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72946"
FT                   /db_xref="GOA:A0A0F6BHP5"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHP5"
FT                   /inference="protein motif:PFAM:PF00636"
FT                   /protein_id="ADP72946.1"
FT                   /translation="MNLLQPVKDVKQMNGLTLAYIGDAVYELYVRHHLLSSGNVKPHQL
FT                   HKRAIQYVSAKAQAKVLLTLLENGILTEEEQSVVRRGRNAKSGTIPKNTDVQTYRYSTA
FT                   FEALIGYHFLGNNEKRVEELIRNSFVIIESEERKS"
     atgaatcttt tgcagccagt caaagatgtg aaacaaatga acggattaac gcttgcttac        60
     attggggatg ccgtatacga attgtacgtg cggcatcacc ttctttccag cggaaatgta       120
     aagccgcatc agcttcataa acgagcgatt caatatgtat cggcaaaagc gcaggcaaaa       180
     gtgctgttaa ccttattgga aaatggaata ttaacagaag aagagcagtc ggtcgttcgc       240
     cgggggcgga acgccaaatc cggcacaatt cccaaaaata cggatgtgca gacgtaccga       300
     tatagtacag catttgaggc actgattgga taccattttt taggtaataa tgaaaaacgg       360
     gtggaggagc ttattcgcaa ttcttttgtg attattgaaa gtgaggaaag gaagtcgtag       420
//

If you have problems or comments...

PBIL Back to PBIL home page