(data stored in ACNUC7421 zone)

EMBL: CP002293.PE91

CP002293.PE91        Location/Qualifiers
FT   CDS_pept        115405..116142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0091"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="KEGG: gwc:GWCH70_0092 RNA methyltransferase, TrmH
FT                   family, group 3; TIGRFAM: RNA methyltransferase, TrmH
FT                   family, group 3; PFAM: tRNA/rRNA methyltransferase (SpoU);
FT                   RNA 2-O ribose methyltransferase substrate binding"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72947"
FT                   /db_xref="GOA:A0A0F6BHP6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHP6"
FT                   /inference="protein motif:TFAM:TIGR00186"
FT                   /protein_id="ADP72947.1"
FT                   /translation="MDFIIGKNPVIEALKSKRQINKIWIAESVQRHSIQPIIQLAKQNG
FT                   VLVQYVPKKKLDQMVEGTHQGIVAQVAAYRYYEIDDLFARASEKNEPPFFLILDELEDP
FT                   HNLGSIMRTADAVGAHGIIIPKRRSVGLTATVAKASTGAIEYIPVARVTNLARTMDELK
FT                   ERGVWIVGTDAKAKEDYRSLDGTMPLALVIGSEGKGIGRLILEKCDFLIRLPMRGHVTS
FT                   LNASVAASLLMYEVYRKRYPLGE"
     atggatttta ttattgggaa aaatcccgtc atcgaggcgc tgaaatcaaa aagacaaatt        60
     aataaaattt ggatagcaga aagtgtgcag cgtcactcta tacaaccgat tattcagctc       120
     gccaagcaaa acggtgtgct tgtgcaatac gttccgaaaa aaaaactcga ccaaatggta       180
     gaagggacgc accagggaat tgtcgctcaa gttgcggcgt accgttatta tgaaatcgat       240
     gatttatttg cacgagcgtc cgaaaaaaac gaaccgccgt tctttctcat tcttgatgaa       300
     ttggaagacc cgcataattt aggatcgatt atgcggacgg ctgatgctgt tggggcgcac       360
     ggcatcatta ttccgaagcg gcgctctgtc ggcttgacgg caacggtcgc gaaagcttcg       420
     acaggggcga tcgaatacat ccctgtcgcg cgcgtgacga atttggcgag aacgatggat       480
     gaattaaaag agcgcggcgt ttggattgtt ggaacagatg ccaaagcgaa agaggactat       540
     cgctcccttg acggaacaat gccgctggct cttgtgattg gcagtgaagg aaaaggaatc       600
     ggaaggctta ttttagaaaa atgcgatttt ctcattcgtt tgccgatgcg agggcatgtt       660
     acgtcattga acgcttctgt cgccgcgagc cttctcatgt atgaggtgta ccgcaaacgc       720
     tatccattag gggaataa                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page