(data stored in ACNUC7421 zone)

EMBL: CP002293.PE92

CP002293.PE92        Location/Qualifiers
FT   CDS_pept        116147..116659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0092"
FT                   /product="protein of unknown function DUF901"
FT                   /note="PFAM: protein of unknown function DUF901; KEGG:
FT                   gwc:GWCH70_0093 protein of unknown function DUF901"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72948"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHP7"
FT                   /inference="protein motif:PFAM:PF05991"
FT                   /protein_id="ADP72948.1"
FT                   /translation="MNILIVDGYNMIGAWPELRKLKEEDDLAAARDLLISKMAEYQGFT
FT                   GDKVIIVFDAHLVQGNAKKYKNHQVEVIFTKENETADERIERLAKSLINVRTKVYVATS
FT                   DYTEQWTIFSQGALRKSARELLMEMESIEKAISKKLQNMKEQTPASRVPLPDEVARIFE
FT                   KWRRGQK"
     atgaatattc tgattgtcga tggctataac atgatcggtg cttggccgga gcttcgcaag        60
     ctaaaggagg aggatgacct tgctgcggca agggatttgt tgatctcgaa aatggccgag       120
     taccaaggat ttactggcga caaagtcatt atcgttttcg atgcgcacct cgtacaaggg       180
     aatgcgaaaa aatacaaaaa tcatcaagtc gaagttattt ttacaaagga aaatgagacc       240
     gcggatgagc ggattgaaag attggcgaaa agcttgatta atgtgcgaac aaaggtgtat       300
     gtcgctactt ccgattatac ggagcaatgg acgattttta gtcaaggggc gctacgcaag       360
     tcggcacggg agcttttaat ggagatggag tcgatcgaaa aagctatttc aaaaaaattg       420
     caaaatatga aagagcaaac cccggcatct agagttccat tgccggacga agtagctcga       480
     attttcgaaa aatggcgaag agggcaaaag tga                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page