(data stored in SCRATCH zone)

EMBL: CP002293.PE96

CP002293.PE96        Location/Qualifiers
FT   CDS_pept        117975..118508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0096"
FT                   /product="NusG antitermination factor"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: NGN domain-containing protein; KOW
FT                   domain protein; KEGG: gwc:GWCH70_0097 NusG antitermination
FT                   factor; SMART: NGN domain-containing protein; KOW domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72952"
FT                   /db_xref="GOA:A0A0F6BHQ1"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHQ1"
FT                   /inference="protein motif:TFAM:TIGR00922"
FT                   /protein_id="ADP72952.1"
FT                   /translation="MEKNWYVIHTYSGYENKVKANLEKRVESMGMQDKIFRIVVPEETE
FT                   TETKSGKKKAAKRKVFPGYVLVEMVMTDDSWYVVRNTPGVTGFVGSSGAGSKPTPLLEE
FT                   EVEMILKRMGMQLAELDVDYELKETVRVKEGPFANFTGTIEEIDVDKRKVKVLVNMFGR
FT                   ETPVEFEFSQIEKI"
     atggaaaaaa actggtatgt cattcatacg tattcaggct atgaaaataa agtgaaagcc        60
     aatttggaaa agcgcgttga gtctatgggg atgcaagata aaattttccg catcgtcgtt       120
     cctgaagaaa cggagacaga aacaaagagc ggcaaaaaga aagcggcaaa aagaaaagta       180
     ttcccggggt acgtgctggt cgagatggta atgaccgatg attcgtggta tgtagtgcgc       240
     aatacgccag gggtaacggg atttgtcggc tcaagcggag ctggttccaa accgacaccg       300
     cttcttgaag aagaagttga aatgatttta aaacggatgg gtatgcagct tgctgagctg       360
     gatgttgatt atgaattaaa agaaacggta agagtgaaag aaggtccttt tgccaatttt       420
     acgggtacaa ttgaagaaat cgatgtggat aaaagaaaag taaaagtgct tgtcaatatg       480
     ttcggccgcg aaacgccagt ggaatttgag ttttcgcaaa ttgaaaaaat atga             534
//

If you have problems or comments...

PBIL Back to PBIL home page