(data stored in ACNUC7421 zone)

EMBL: CP002293.PE97

CP002293.PE97        Location/Qualifiers
FT   CDS_pept        118754..119179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0097"
FT                   /product="ribosomal protein L11"
FT                   /note="TIGRFAM: ribosomal protein L11; PFAM: Ribosomal
FT                   protein L11-like; KEGG: ribosomal protein L11; SMART:
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72953"
FT                   /db_xref="GOA:A0A0F6BHQ2"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHQ2"
FT                   /inference="protein motif:TFAM:TIGR01632"
FT                   /protein_id="ADP72953.1"
FT                   /translation="MAKKVVKVVKLQIPAGKANPAPPVGPALGQAGVNIMAFCKEFNAR
FT                   TADQAGLIIPVEITVYEDRSFTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDK
FT                   VREIAELKMPDLNAASIEAAMRMVEGTARSMGIVIED"
     gtggcaaaaa aagttgttaa agtcgtaaaa ctacaaattc ctgcaggcaa agcgaatccg        60
     gcaccgccag ttggtccagc gttaggtcaa gccggtgtta atattatggc attttgcaaa       120
     gagttcaatg ctcgcacagc tgaccaagca ggtttaatta ttccggttga aattacggta       180
     tatgaagacc gttcatttac atttattaca aaaactccgc cagctgcagt gttattgaaa       240
     aaagcggccg gcatcgaatc tggttccggt gaaccgaacc gcaataaagt agcgacaatc       300
     aaacgcgata aagtgcgcga gattgccgaa ttgaaaatgc cggatttaaa cgcggcgagc       360
     atcgaagctg cgatgcgcat ggttgaaggt acggcccgca gcatgggcat cgttatcgaa       420
     gactaa                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page