(data stored in ACNUC7421 zone)

EMBL: CP002293.PE98

CP002293.PE98        Location/Qualifiers
FT   CDS_pept        119287..119988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0098"
FT                   /product="ribosomal protein L1"
FT                   /note="KEGG: gwc:GWCH70_0099 ribosomal protein L1; TIGRFAM:
FT                   ribosomal protein L1; PFAM: ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72954"
FT                   /db_xref="GOA:A0A0F6BHQ3"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHQ3"
FT                   /inference="protein motif:TFAM:TIGR01169"
FT                   /protein_id="ADP72954.1"
FT                   /translation="MPRRGKKYLEALKLVDRSKAYPVAEAIELVKKTNIAKFDATVEVA
FT                   FRLGVDPKKADQQIRGAVVLPHGTGKVQRVLVFAKGEKAKEAEAAGADYVGDTEYINKI
FT                   QEGWFDFDVVVATPDMMGEVGKLGRILGPKGLMPNPKTGTVTFDVAKAVQEIKAGKVEY
FT                   RVDKAGNIHVPIGKVSFDNEKLVENFTTIYEAILKAKPAAAKGTYVKNVTVTSTMGPGI
FT                   KVDPSTVAVAQ"
     atgccaagaa gaggaaaaaa atacttagaa gcattaaaac ttgtggaccg ctcaaaagcg        60
     tatccagttg cggaagcgat tgagcttgtt aagaaaacaa acattgcgaa atttgacgcg       120
     acagtggaag tggcgttccg tttaggcgtt gatccgaaaa aagcggacca acaaatccgc       180
     ggcgcggttg tattgccaca tggtacaggg aaagtacaac gcgttttagt attcgcgaaa       240
     ggcgaaaaag cgaaagaagc ggaagctgcc ggcgctgact atgttggcga tactgaatac       300
     atcaacaaaa tccaagaagg ctggtttgac tttgatgtcg ttgttgccac tccggacatg       360
     atgggggaag taggtaaatt aggacgcatt ttaggtccga aaggattaat gccaaacccg       420
     aaaaccggca cggtaacgtt tgacgttgcg aaagccgtac aagaaattaa agctggtaaa       480
     gtggaatatc gtgtggataa agccggcaac atccatgtgc cgattggcaa agtttcgttt       540
     gacaacgaaa agctcgtgga aaacttcact acgatttacg aagcgatttt aaaagcaaaa       600
     ccggctgccg ctaaaggcac ttatgtgaaa aacgtcaccg ttacttcaac gatggggcct       660
     ggcatcaaag tagacccatc tacggttgct gtagcgcaat aa                          702
//

If you have problems or comments...

PBIL Back to PBIL home page