(data stored in ACNUC7421 zone)

EMBL: CP002299.PE10

CP002299.PE10        Location/Qualifiers
FT   CDS_pept        14660..15937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0010"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL0023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78098"
FT                   /db_xref="GOA:E3J260"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:E3J260"
FT                   /inference="similar to AA sequence:KEGG:FRAAL0023"
FT                   /protein_id="ADP78098.1"
FT                   /translation="MASTDAFAAQPSAAPHEATVRPTVPTRRGVLAPDRLADLHPLARP
FT                   PETSPLLTAAEVRATADSIAAMQDPDGAIPWFPGGHTDAWDHLECAMALELGGRDDAAQ
FT                   RAWDWLLRNQRDDGSWATSYIGGGVRENFADSNQCAYVATAVWHHWRRTGDAAFVAGMW
FT                   PVVRAALDFVIDMQAPSGVIWWARDAEGKDYPLAMLTGCSSTLHSLRCGLGLAALVGDA
FT                   RPDWELAAGRLAHALRAHPEYFAPTSRWSMDWYYPVIGGALRGAEGLERLRGRWAEFVI
FT                   EGLGIRCVSDEPWVTGAETCELAIALHLVGETAAARTLVRDMQHLRHHDGAYWTGWQFV
FT                   GGAHWPDERSTWTAAAVILAVDTLSGGVTEAVFRGDGLPEPLPTLAPDGEELDDVEALD
FT                   RLGCDCDPAPVIGAWSNDELAGRLAS"
     atggcgtcga ctgacgcgtt cgcggctcag ccgtccgcgg cgccccacga ggcgaccgtg        60
     cgaccgacgg tgcccaccag gcgcggcgtg ctcgctcccg accggctggc cgatctgcac       120
     ccgctggccc gtccgcccga gaccagcccg ttgctgacgg cggccgaggt ccgggcgacg       180
     gccgactcga tcgccgcgat gcaggacccg gacggcgcga tcccgtggtt cccgggcggt       240
     cacaccgacg cctgggacca tctcgagtgc gcgatggcgc tggagctcgg cgggcgcgac       300
     gacgccgccc agcgggcctg ggactggctg ctgcgcaacc agcgcgacga cgggtcctgg       360
     gcgaccagct acatcggcgg cggcgtccgg gagaacttcg ccgacagcaa ccagtgcgcc       420
     tacgtcgcca cggccgtctg gcaccactgg cgacgcaccg gcgacgctgc cttcgtggcc       480
     gggatgtggc cggtggtgcg cgcggcgctg gacttcgtca tcgacatgca ggcgcccagc       540
     ggggtgatct ggtgggcccg cgacgccgag ggcaaggact acccgctcgc gatgctgacg       600
     ggctgctcca gcacgctgca cagcctgcgc tgcgggctgg gccttgccgc gctcgtcggc       660
     gacgcgcggc cggactggga actggccgcc ggccggctcg cgcacgcgtt gcgggcccat       720
     ccggagtact tcgcgccgac gtcgcgctgg tcgatggact ggtactaccc ggtgatcggc       780
     ggagcgctgc gcggagcgga aggtctggag cgcctgcgcg gccgctgggc cgaattcgtc       840
     atcgaaggcc tgggaatccg ctgcgtctcc gacgaaccgt gggtcaccgg cgcggagacc       900
     tgtgagttgg cgatcgccct gcacctcgtc ggcgagaccg cggcggcgcg caccctggtc       960
     cgggacatgc agcacctgcg tcaccacgac ggtgcctact ggaccggctg gcagttcgtg      1020
     ggcggcgccc actggccgga cgagcgcagc acctggaccg ccgcggccgt catcctggcc      1080
     gtcgacaccc tctccggcgg cgtcaccgag gccgtcttcc gcggcgacgg cctgcccgag      1140
     ccgctgccca cgctggcgcc ggacggcgag gagctcgacg atgtcgaggc cctcgaccgg      1200
     ctcggctgcg actgcgaccc cgcaccggtc atcggcgcgt ggtcgaacga tgagctggcc      1260
     ggccggctgg ccagctag                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page